Najpopularniejszy w Polsce portal o finansach i biznesie
Money.plTechnologie dla biznesuPrzemysłPatentyEP 1748954 T3
Wyszukiwarka patentów
  • od
  • do
Patent EP 1748954 T3


EP 1748954 T3

RZECZPOSPOLITA POLSKA (12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (96) Data i numer zgłoszenia patentu europejskiego: 08.03.2005 05727242.9 (19) PL (11) PL/EP (13) (51) 1748954 T3 Int.Cl. C12N 9/20 (2006.01) C12N 1/20 (2006.01) Urząd Patentowy Rzeczypospolitej Polskiej (54) (97) O udzieleniu patentu europejskiego ogłoszono: 17.08.2016 Europejski Biuletyn Patentowy 2016/33 EP 1748954 B1 C12N 15/00 (2006.01) C07H 21/04 (2006.01) Tytuł wynalazku: Fosfolipazy, kodujące je kwasy nukleinowe i sposoby ich wytwarzania i stosowania (30) (43) Pierwszeństwo: 08.03.2004 US 796907 Zgłoszenie ogłoszono: 07.02.2007 w Europejskim Biuletynie Patentowym nr 2007/06 (45) O złożeniu tłumaczenia patentu ogłoszono: 28.02.2017 Wiadomości Urzędu Patentowego 2017/02 (73) Uprawniony z patentu: DSM IP Assets B.V., Heerlen, NL PL/EP 1748954 T3 (72) Twórca(y) wynalazku: SVETLANA GRAMATIKOVA, San Diego, US GEOFF HAZLEWOOD, San Diego, US DAVID LAM, San Marcos, US NELSON R. BARTON, San Diego, US BLAKE G. STURGIS, CArlsbad, US DAN E. ROBERTSON, San Diego, US JINCAI LI, San Diego, US JOEL A. KREPS, Encinitas, US RODERICK FIELDING, San Diego, US ROBERT C. BROWN, San Diego, US AMIT VASAVADA, Poway, US XUQIU TAN, San Diego, US ADRIAN BADILLO, Poway, US WILHELMUS P. VAN HOEK, Camarillo, US GISELLE JANSSEN, San Diego, US CHARLES ISAAC, Carlsbad, US MARK J. BURK, San Diego, US (74) Pełnomocnik: rzecz. pat. Dorota Rzążewska JWP RZECZNICY PATENTOWI DOROTA RZĄŻEWSKA SP. J. ul. Żelazna 28/30 Sienna Center 00-833 Warszawa Uwaga: W ciągu dziewięciu miesięcy od publikacji informacji o udzieleniu patentu europejskiego, każda osoba może wnieść do Europejskiego Urzędu Patentowego sprzeciw dotyczący udzielonego patentu europejskiego. Sprzeciw wnosi się w formie uzasadnionego na piśmie oświadczenia. Uważa się go za wniesiony dopiero z chwilą wniesienia opłaty za sprzeciw (Art. 99 (1) Konwencji o udzielaniu patentów europejskich). 27855/16/ZWA/DR EP 1 748 954 Fosfolipazy, kodujące je kwasy nukleinowe i sposoby ich wytwarzania i stosowania Opis DZIEDZINA WYNALAZKU [0001] Wynalazek ten dotyczy w ogólności enzymów fosfolipazy, polinukleotydów kodujących te enzymy, sposobów wytwarzania i stosowania tych polinukleotydów i polipeptydów. Niniejszy wynalazek dotyczy zwłaszcza nowych polipeptydów o aktywności fosfolipazy, kodujących je kwasów nukleinowych i przeciwciał, które wiążą się z nimi. Zapewnione są także sposoby przemysłowe i produkty zawierające te fosfolipazy. TŁO [0002] Fosfolipazy są enzymami, które hydrolizują wiązania estrowe fosfolipidów. Odpowiednio do ich znaczenia w metabolizmie fosfolipidów, enzymy te są szeroko rozpowszechnione u prokariotów i eukariotów. Fosfolipazy wpływają na metabolizm, budowę i reorganizację błon biologicznych i są zaangażowane w kaskadach sygnałowych. Znanych jest kilka typów fosfolipaz, które różnią się pod względem ich specyficzności w odpowiedniej pozycji wiązania atakowanego w cząsteczce fosfolipidu. Fosfolipaza A1 (PLA1) usuwa kwas tłuszczowy w pozycji 1 z wytworzeniem wolnego kwasu tłuszczowego i 1-lizo-2-acylofosfolipidu. Fosfataza A2 (PLA2) usuwa kwas tłuszczowy z pozycji 2 do wytworzenia wolnego kwasu tłuszczowego oraz 1-acylo-2-lizofosfolipidu. Enzymy PLA1 i PLA2 mogą być wewnątrz- i zewnątrzkomórkowe, związane z błoną lub rozpuszczalne. Wewnątrzkomórkowy PLA2 można znaleźć w prawie każdej komórce ssaka. Fosfolipaza C (PLC) usuwa grupę fosforanową dając 1,2-diacyloglicerol i ester fosforanowy. Fosfolipaza D (PLD) daje 1,2-diacyloglicerofosforan i zasadową grupę. PLC i PLD są ważne pod względem funkcjonalności i sygnalizacji komórkowej. PLD była dominującą fosfolipazą w biokatalizie (patrz, np. Godfrey, T. i West S. (1996) Industrial enzymology, 299-300, Stockton Press, New York). Patatyny to inny rodzaj fosfolipazy, które uważa się za działające jak PLA (patrz na przykład, Hirschberg HJ, i wsp., (2001), Eur J Biochem 268(19):5037-44). [0003] Powszechnie występujące nasiona oleiste takie, jak nasiona soi, nasiona rzepaku, nasiona słonecznika, olej z otrębów ryżowych, sezam i orzeszki arachidowe są stosowane jako źródła olejów i surowiec. W sposobie ekstrakcji oleju nasiona są poddawane obróbce mechanicznej i termicznej. Olej jest oddzielany i rozdzielany od miazgi poprzez rozpuszczalnik. Przy użyciu destylacji, rozpuszczalnik jest następnie oddzielany od oleju i odzyskiwany. Olej jest ?odśluzowany? i rafinowany. Rozpuszczalnik zawarty w miazdze można odparowywać poprzez obróbkę termiczną w urządzeniu grzewczym do usuwania rozpuszczalnika, typu DT ang. ?desolventizer toaster?, a następnie suszy się i schładza miazgę. Po oddzieleniu rozpuszczalnika poprzez destylację, wyprodukowany surowy olej jest poddawany obróbce do jadalnego oleju, przy użyciu specjalnych procedur odśluzowywania i fizycznego rafinowania. Może on również być stosowany jako surowiec do produkcji kwasów tłuszczowych i estru metylowego. Miazgę można stosować do dawek pokarmowych dla zwierząt. -2- [0004] Odśluzowywanie jest pierwszym etapem w rafinowaniu oleju roślinnego i jest zaprojektowane do usuwania zanieczyszczających fosfatydów, które są ekstrahowane olejem, ale zakłócają późniejszą obróbkę oleju. Te fosfatydy są rozpuszczalne w oleju roślinnym wyłącznie w postaci bezwodnej, i mogą być strącane i usuwane jeżeli zostaną one po prostu uwodnione. Uwodnienie zazwyczaj osiąga się poprzez nieprzerwane mieszanie niewielkiej części wody z zasadniczo bezwodnym olejem. Typowo, ilość wody wynosi 75% zawartości fosfatydów, która wynosi typowo 1 do 1,5%. Temperatura nie ma wysoce kluczowego znaczenia, chociaż rozdział uwodnionych substancji śluzowych jest lepszy, gdy lepkość oleju jest obniżona w 50°C do 80°C. [0005] Obecnie stosuje się wiele sposobów odśluzowywania oleju. Sposób odśluzowywania oleju można wspomagać enzymatycznie poprzez zastosowanie enzymów fosfolipazy. Fosfolipazy A1 i A2 stosowano do odśluzowywania oleju w różnych procesach komercyjnych, np. ?odśluzowywanie ENZYMAX?? (Lurgi Life Science Technologies GmbH, Niemcy). Rozważano również fosfolipazę C (PLC) do odśluzowywania oleju, ponieważ ugrupowanie fosforanowe, generowane poprzez jej działanie na fosfolipidy jest bardzo rozpuszczalne w wodzie i łatwe do usunięcia, a digliceryd pozostaje z olejem i obniża straty; patrz np. Godfrey, T. i West S. (1996) Industrial Enzymology, str.299-300, Stockton Press, New York; Dahlke (1998) ?An enzymatic process for the physical refining of seed oils? Chem. Eng. Technol. 21:278-281; Clausen (2001) ?Enzymatic oil degumming by a novel microbial phospholipase? Eur. J. Lipid Sci. Technol. 103:333-340. [0006] Oleje o wysokiej zawartości fosfatydów takie, jak sojowy, rzepakowy canola i słonecznikowy są przetwarzane inaczej niż inne oleje takie, jak palmowy. W przeciwieństwie do procesu parowego lub ?fizycznego rafinowania? dla olejów o niskiej zawartości fosfatydów, te oleje o wysokiej zawartości fosforu wymagają specjalnej chemicznej i mechanicznej obróbki, aby usunąć fosfolipidy zawierające fosfor. Te oleje są typowo rafinowane chemicznie w procesie, który pociąga za sobą zobojętnianie wolnych kwasów tłuszczowych, w celu utworzenia mydła i nierozpuszczalnej frakcji substancji śluzowych. Proces zobojętniania jest wysoce skuteczny w usuwaniu wolnych kwasów tłuszczowych i fosfolipidów, ale proces ten powoduje również istotne spadki wydajności i pogorszenie jakości. W niektórych przypadkach, wysokofosfatydowy surowy olej jest odśluzowywany na etapie poprzedzającym kaustyczne zobojętnienie. Dzieje się tak w przypadku oleju sojowego, stosowanego ze względu na lecytynę, przy czym olej jest najpierw odśluzowany wodą lub kwasem. [0007] Fitosterole (sterole roślinne) są członkami rodziny ?triterpenowej? naturalnych produktów, która obejmuje ponad 100 różnych fitosteroli i ponad 4000 innych rodzajów triterpenów. Na ogół, uważa się, że fitosterole stabilizują błony roślinne, przy wzroście stosunku sterolu/fosfolipidów prowadzącym do sztywnienia błony. Chemicznie, fitosterole przypominają cholesterol w strukturze i uważa się, że regulują płynność błony w błonach roślin, podobnie jak poziom cholesterolu w błonach zwierząt. Głównymi fitosterolami są ?sitosterol, kampesterol i stigmasterol. Inne obejmują stigmastanol (?-sitostanol), sitostanol, desmosterol, dihydrobrasykasterol, chalinasterol, poriferasterol, clionasterol i brasykasterol. -3- [0008] Sterole roślinne są ważnymi produktami rolnymi dla przemysłu zdrowia i odżywiania. Są one użyteczne dla producentów emulgatory kosmetycznych i dostarczają większość niesteroidowych związków pośrednich i prekursorów do wytwarzania leków hormonalnych. Zasugerowano, że nasycone analogi i ich estrów fitosteroli sa skutecznymi środkami obniżającymi poziom cholesterolu z kardiologicznymi korzyściami zdrowotnymi. Sterole roślinne obniżają poziom cholesterolu w surowicy poprzez hamowanie wchłaniania cholesterolu w świetle jelita i mają właściwości immunomodulujące w bardzo niskich stężeniach, w tym lepszą odpowiedź komórkową limfocytów T i zdolność cytotoksyczną komórek naturalnych zabójców wobec linii komórek nowotworu. Ponadto, ich działanie terapeutyczne wykazano w badaniach klinicznych w leczeniu gruźlicy płuc, reumatoidalnego zapalenia stawów, leczeniu pacjentów zakażonych HIV i hamowaniu stresu immunologicznego u maratończyków. [0009] Estry roślinnych steroli, określane także jako estry fitosteroli, zostały zatwierdzone jako GRAS (ang. Generally Recognized As Safe, ogólnie uważane za bezpieczne) przez US Food and Drug Administration (FDA) do stosowania w margarynach i smarowidłach w 1999. We wrześniu 2000 roku FDA wydała również tymczasową regułę, która umożliwia znakowanie zdrowotnym stwierdzeniami pokarmów zawierających ester fitosteroli. W konsekwencji wzbogacanie żywności w estry fitosteroli jest wysoce pożądane dla akceptacji konsumentów. [0010] Olej sojowy jest powszechnie stosowany i jest ważnym środkiem spożywczym, który stanowi ~ 30% produkcji oleju z nasion i owoców. Nasiona soi zawierają jedynie 20% oleju, i ekstrakcja jest zazwyczaj prowadzona przy użyciu rozpuszczalnika takiego, jak heksan, na skalę komercyjną. Uznana jakość jej oleju i wartość odżywcza białka mączki czynią soję podstawowym nasionem oleistym. Przed ekstrakcją nasiona soi należy oczyścić, rozbić i rozkruszyć, jako że skuteczna ekstrakcja oleju za pomocą rozpuszczalnika wymaga, żeby każda komórka oleju została rozbita, w celu poprawy przenoszenia masy. Ściany komórkowe, zbudowane głównie z celulozy, powiązanej z hemicelulozami, substancjami pektynowymi i ligniną), można również rozbijać enzymatycznie, w celu osiągnięcia istotnej poprawy w wydajności i szybkości ekstrakcji. [0011] Olej diacyloglicerolowy (DAG) to jadalny olej zawierający 80% lub większą ilość DAG niż naturalne kwasy tłuszczowe. U ludzi wykazano, że poposiłkowe podwyższenie stężenia trójglicerydu w chylomikronach jest wyraźnie mniejsze po spożyciu emulsji ? oleju DAG, w porównaniu do oleju TAG dla podobnej kompozycji kwasu tłuszczowego. W badaniach prowadzonych na Japończykach, Amerykanach i Amerykankach długoterminowe spożywanie oleju DAG stymulowało zmniejszenie masy ciała i obniżenie poziomu tkanki tłuszczowej. Jedno z badań wykazało, że zastąpienie olejem DAG zwykłego oleju spożywczego zmniejsza częstość występowania otyłości i innych czynników ryzyka. STRESZCZENIE [0012] Ujawnienie zapewnia wyizolowane lub rekombinowane kwasy nukleinowe zawierające sekwencję kwasu nukleinowego mającą co najmniej około 50%, 51%, 52%, 53%, -4- 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do przykładowego kwasu nukleinowego według ujawnienia, np. SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, SEQ ID NO:71, SEQ ID NO:73, SEQ ID NO:75, SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:91, SEQ ID NO:93, SEQ ID NO:95, SEQ ID NO:97, SEQ ID NO:99, SEQ ID NO:101, SEQ ID NO:103, SEQ ID NO:105, SEQ ID NO:107, SEQ ID NO:109, SEQ ID NO:111, SEQ ID NO:113, SEQ ID NO:115, SEQ ID NO:117, SEQ ID NO:119, SEQ ID NO:121, SEQ ID NO:123, SEQ ID NO:125, SEQ ID NO:127, SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ ID NO:135, SEQ ID NO:137, SEQ ID NO:139, SEQ ID NO:141, SEQ ID NO:143, SEQ ID NO:145, SEQ ID NO:147, SEQ ID NO:149, SEQ ID NO:151, SEQ ID NO:153, SEQ ID NO:155, SEQ ID NO:157, SEQ ID NO:199, SEQ ID NO:161, SEQ ID NO:163, SEQ ID NO:165, SEQ ID NO:167, SEQ ID NO:169, SEQ ID NO:171 lub SEQ ID NO:173, na regionie co najmniej około 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, 1950, 2000, 2050, 2100, 2200, 2250, 2300, 2350, 2400, 2450, 2500, lub więcej reszt, i w jednym aspekcie kwas nukleinowy koduje co najmniej jeden polipeptyd mający aktywność fosfolipazy (PL), np. aktywność fosfolipazy A, C lub D, lub dowolną kombinację aktywności fosfolipazy, na przykład, aktywność PL A, PL C i/lub PL D - jako wielofunkcyjna aktywność. W jednym aspekcie, identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. [0013] Ujawnienie zapewnia wyizolowane lub rekombinowane kwasy nukleinowe zawierające sekwencję kwasu nukleinowego mającą co najmniej 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, lub 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do SEQ ID NO:1 na regionie co najmniej około 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850 więcej kolejnych reszt, i w jednym aspekcie kwas nukleinowy koduje co najmniej jeden polipeptyd mający aktywność fosfolipazy (PL), np. aktywność fosfolipazy A, C lub D, lub dowolną kombinację aktywności fosfolipazy, na przykład, aktywność PL A, PL C i/lub PL D - jako wielofunkcyjna aktywność. W jednym aspekcie, identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. -5- [0014] Ujawnienie zapewnia wyizolowane lub rekombinowane kwasy nukleinowe zawierające sekwencję kwasu nukleinowego mającą co najmniej 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do SEQ ID NO:3 na regionie co najmniej około 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850 lub więcej reszt, i w jednym aspekcie kwas nukleinowy koduje co najmniej jeden polipeptyd mający aktywność fosfolipazy (PL), np. aktywność fosfolipazy A, C lub D, lub dowolną kombinację aktywności fosfolipazy, na przykład, aktywność PL A, PL C i/lub PL D - jako wielofunkcyjna aktywność. W jednym aspekcie, identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. [0015] Ujawnienie zapewnia wyizolowane lub rekombinowane kwasy nukleinowe zawierające sekwencję kwasu nukleinowego mającą co najmniej 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do SEQ ID NO:5 na regionie co najmniej około 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850 lub więcej reszt, i w jednym aspekcie kwas nukleinowy koduje co najmniej jeden polipeptyd mający aktywność fosfolipazy (PL), np. aktywność fosfolipazy A, C lub D, lub dowolną kombinację aktywności fosfolipazy, na przykład, aktywność PL A, PL C i/lub PL D - jako wielofunkcyjna aktywność. W jednym aspekcie, identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. [0016] Ujawnienie zapewnia wyizolowane lub rekombinowane kwasy nukleinowe zawierające sekwencję kwasu nukleinowego mającą co najmniej 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do SEQ ID NO:7 na regionie co najmniej około 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850 lub więcej reszt, i w jednym aspekcie kwas nukleinowy koduje co najmniej jeden polipeptyd mający aktywność fosfolipazy (PL), np. aktywność fosfolipazy A, C lub D, lub dowolną kombinację aktywności fosfolipazy, na przykład, aktywność PL A, PL C i/lub PL D - jako wielofunkcyjna aktywność. W jednym aspekcie, identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. [0017] Alternatywnie, wyizolowany lub rekombinowany kwas nukleinowy koduje polipeptyd zawierający sekwencję jak podaną w SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID -6- NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:74, SEQ ID NO:76, SEQ ID NO:78, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, SEQ ID NO:92, SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:102, SEQ ID NO:104, SEQ ID NO:106, SEQ ID NO:108 SEQ ID NO:110, SEQ ID NO:112, SEQ ID NO:114, SEQ ID NO:116, SEQ ID NO:118, SEQ ID NO:120, SEQ ID NO:122, SEQ ID NO:124, SEQ ID NO:126, SEQ ID NO:128, SEQ ID NO:130, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:136, SEQ ID NO:138; SEQ ID NO:140; SEQ ID NO:142; SEQ ID NO:144; NO:146, SEQ ID NO:148, SEQ ID NO:150, SEQ ID NO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ ID NO:168, SEQ ID NO:170, SEQ ID NO:172, lub SEQ ID NO:174. W jednym aspekcie te polipeptydy mają aktywność fosfolipazy, np. fosfolipazy A, B, C lub D, lub dowolną kombinację aktywności fosfolipazy, na przykład, aktywność PL A, PL C i/lub PL D - jako wielofunkcyjna aktywność. [0018] W jednym aspekcie, algorytmem porównywania sekwencji jest algorytm BLAST taki, jak algorytm BLAST wersja 2.2.2. W jednym aspekcie, filtering setting jest ustawione na blastall -p blastp -d ?nr pataa? -F F, a wszystkie inne opcje są ustawione domyślnie. [0019] W jednym aspekcie, aktywność fosfolipazy obejmuje hydrolizę katalizującą wiązania estrowego glicerolofosforanu (tj. rozszczepienie wiązań estrowych glicerolofosforanu). Aktywność fosfolipazy może obejmować katalizującą hydrolizę wiązania estrowego w fosfolipidzie w oleju roślinnym. Fosfolipid z oleju roślinnego może zawierać fosfolipid z nasion oleistych. Aktywność fosfolipazy może obejmować aktywność fosfolipazy C (PKC); aktywność fosfolipazy A (PLA) taką, jak aktywność fosfolipazy A1 lub fosfolipazy A2; aktywność fosfolipazy D (PLD) taką, jak aktywność fosfolipazy D1 lub fosfolipazy D2; aktywność fosfolipazy B (PLB), np. aktywność fosfolipazy i lizofosfolipazy (LPL) lub aktywność fosfolipazy i lizofosfolipazy-transacylazy (LPTA) lub aktywność fosfolipazy i lizofosfolipazy (LPL) i aktywność lizofosfolipazy-transacylazy (LPTA); lub aktywność patatyny, lub ich kombinację. Aktywność fosfolipazy może obejmować hydrolizę glikoproteiny, np. jako glikoproteiny występującej w bulwie ziemniaczanej. Aktywność fosfolipazy może obejmować aktywność enzymatyczną patatyny. Aktywność fosfolipazy może obejmować aktywność acylohydrolazy lipidów (LAH). W jednym aspekcie, fosfolipaza według wynalazku może mieć aktywność wielofunkcyjną, np. kombinację jednej lub większej liczby aktywności enzymatycznych tu opisanych, na przykład, fosfolipaza według wynalazku może mieć aktywność PLC i PLA; aktywność PLB i PLA; aktywność PLC i PLD; aktywność PLC i PLB; aktywność PLB i patatyny; aktywność PLC i patatyny; aktywność PLD i PLA; aktywność PLD, PLA, PLB i PLC; lub aktywność PLD, PLA, PLB, PLC i patatyny; lub, aktywność fosfolipazy i lizofosfolipazy (LPL) lub aktywność fosfolipazy i lizofosfolipazytransacylazy (LPTA) lub aktywność fosfolipazy i lizofosfolipazy (LPL) oraz aktywność lizofosfolipazy-transacylazy (LPTA) lub dowolne ich kombinacje. -7- [0020] Na przykład, polipeptyd według ujawnienia jest aktywny enzymatycznie, ale brak mu aktywności lipazy, np. nie ma żadnej aktywności enzymatycznej, która wpływa na obojętną frakcję oleju (trójglicerydy). Może być pożądane zastosowanie takiego polipeptydu w określonym sposobie, np. w sposobie odśluzowania gdzie ważne jest, aby frakcja oleju obojętnego nie była naruszona (zmniejszona, np. zhydrolizowana). Zatem, w jednym aspekcie, ujawnienie zapewnia sposób odśluzowania obejmujący zastosowanie polipeptydu według ujawnienia mającego aktywność fosfolipazy, ale nie aktywność lipazy. [0021] Ujawniony tu wyizolowany lub rekombinowany kwas nukleinowy koduje polipeptyd mający aktywność fosfolipazy, która jest termostabilna. Polipeptyd może zachować aktywność fosfolipazy w warunkach obejmujących zakres temperatur pomiędzy około 20°C do około 30°C, pomiędzy około 25°C do około 40°C, pomiędzy około 37°C do około 95°C; pomiędzy około 55°C do około 85°C, pomiędzy około 70°C do około 95°C, lub, pomiędzy około 90°C do około 95°C. W innym aspekcie, wyizolowany lub rekombinowany kwas nukleinowy koduje polipeptyd mający aktywność fosfolipazy, która jest termotolerancyjna. Polipeptyd może zachować aktywność fosfolipazy po ekspozycji do temperatury w zakresie od więcej niż 37°C do około 95°C lub gdziekolwiek w zakresie od więcej niż 55°C do około 85°C. Na przykład, polipeptyd zachowuje aktywność fosfolipazy po ekspozycji do temperatury w zakresie od więcej niż 90°C do około 95°C w pH 4,5. [0022] Polipeptyd może zachować aktywność fosfolipazy w warunkach zawierających około pH 8, pH 7,5, pH 7, pH 6,5, pH 6.0, pH 5,5, pH 5, lub pH 4,5. Polipeptyd może zachować aktywność fosfolipazy w warunkach obejmujących zakres temperatur pomiędzy około 40°C do około 70°C. [0023] Ujawnienie zapewnia wyizolowany lub rekombinowany kwas nukleinowy, który zawiera sekwencję, która hybrydyzuje w warunkach rygorystycznych do sekwencji jak podano w SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, SEQ ID NO:71, SEQ ID NO:73, SEQ ID NO:75, SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:91, SEQ ID NO:93, SEQ ID NO:95, SEQ ID NO:97, SEQ ID NO:99, SEQ ID NO:101, SEQ ID NO:103, SEQ ID NO:105, SEQ ID NO:107, SEQ ID NO:109, SEQ ID NO:111, SEQ ID NO:113, SEQ ID NO:115, SEQ ID NO:117, SEQ ID NO:119, SEQ ID NO:121, SEQ ID NO:123, SEQ ID NO:125, SEQ ID NO:127, SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ ID NO:135, SEQ ID NO:137, SEQ ID NO:139, SEQ ID NO:141, SEQ ID NO:143, SEQ ID NO:145, SEQ ID NO:147, SEQ ID NO:149, SEQ ID NO:151, SEQ ID NO:153, SEQ ID NO:155, SEQ ID NO:157, SEQ ID NO:159, SEQ ID NO:161, SEQ ID NO:163, SEQ ID NO:165, SEQ ID NO:167, SEQ ID NO:169, SEQ ID NO:171 lub SEQ ID NO:173, przy czym kwas nukleinowy koduje -8- polipeptyd mający aktywność fosfolipazy. Kwas nukleinowy może co najmniej 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850 lub reszt długości lub pełną długość genu lub transkryptu, z lub bez sekwencji sygnałowej, jak tu opisano. Rygorystyczne warunki mogą być wysoce rygorystyczne, umiarkowanie rygorystyczne lub o niskiej rygorystyczności, jak tu opisano. Rygorystyczne warunki mogą obejmować etap przemywania, np. etap przemywania obejmujący przemywanie w 0,2X SSC w temperaturze około 65°C przez około 15 minut. [0024] Ujawnienie zapewnia sondę kwasu nukleinowego dla identyfikacji kwasu nukleinowego kodującą polipeptyd o aktywności fosfolipazy, np. fosfolipazy, przy czym sonda zawiera co najmniej 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, lub więcej, kolejnych zasad sekwencji według ujawnienia, np. sekwencji jak podano w SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, lub SEQ ID NO:7, a sonda rozpoznaje kwas nukleinowy poprzez wiązanie lub hybrydyzację. Sonda może zawierać oligonukleotyd zawierający co najmniej około 10 do 50, około 20 do 60, około 30 do 70, około 40 do 80, lub około 60 do 100 kolejnych zasad sekwencji jak podano w SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5 i/lub SEQ ID NO:7. [0025] Ujawnienie zapewnia sondę kwasu nukleinowego dla identyfikacji kwasu nukleinowego kodującego polipeptyd z fosfolipazą, na przykład, aktywnością fosfolipazy, przy czym sonda zawiera kwas nukleinowy według ujawnienia, np. kwas nukleinowy mający co najmniej 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5 i/lub SEQ ID NO:7, lub jej podsekwencji, na regionie co najmniej około 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850 lub więcej kolejnych reszt; i, w jednym aspekcie, identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. [0026] Ujawnienie zapewnia parę sekwencji starterów do amplifikacji dla amplifikacji kwasu nukleinowego kodującego polipeptyd mający aktywność fosfolipazy, przy czym para starterów jest zdolna do amplifikacji kwasu nukleinowego zawierającego sekwencję według ujawnienia, lub jej fragmenty lub podsekwencje. Jeden lub każdy element pary sekwencji starterów do amplifikacji może zawierać oligonukleotyd zawierający co najmniej około 10 do 50 kolejnych zasad sekwencji, lub około 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, lub 25 lub więcej kolejnych zasad sekwencji. [0027] Ujawnienie zapewnia pary starterów do amplifikacji, przy czym para starterów zawiera pierwszy element mający sekwencję, jak określono przez około pierwsze (5') 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, lub 25 lub więcej reszt kwasu nukleinowego według ujawnienia, i drugi element mający sekwencję, jak określono przez około pierwsze (5') 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, lub 25 lub więcej reszt komplementarnej nici pieszego elementu. -9- [0028] Ujawnienie zapewnia fosfolipazy wytwarzane przez amplifikację, np. reakcję łańcuchową polimerazy (PCR), przy użyciu pary starterów do amplifikacji według ujawnienia. Ujawnienie zapewnia sposoby wytwarzania fosfolipazy przez amplifikację, np. reakcję łańcuchową polimerazy (PCR), przy użyciu pary starterów do amplifikacji według ujawnienia. W jednym aspekcie, para starterów do amplifikacji amplifikuje kwas nukleinowy z biblioteki, np. biblioteki genów takich, jak biblioteka środowiskowa. [0029] Ujawnienie zapewnia sposoby amplifikacji kwasu nukleinowego kodującego polipeptyd mający aktywność fosfolipazy obejmujący amplifikację matrycowego kwasu nukleinowego za pomocą pary sekwencji starterów do amplifikacji zdolnej do amplifikacji sekwencji kwasu nukleinowego według ujawnienia, lub jej fragmentów lub podsekwencji. Para starterów do amplifikacji może być parą starterów do amplifikacji według ujawnienia. [0030] Wynalazek zapewnia kasety ekspresyjne zawierające kwas nukleinowy według wynalazku lub jego podsekwencję. W jednym aspekcie, kaseta ekspresyjna może zawierać kwas nukleinowy, który jest funkcjonalnie połączony z promotorem. Promotor może oznaczać promotor wirusowy, bakteryjny, ssaczy lub roślinny. W jednym aspekcie, promotor roślinny może oznaczać promotor ziemniaka, ryżu, kukurydzy, pszenicy, tytoniu lub jęczmienia. Promotor może oznaczać konstytutywny promotor. Konstytutywny promotor może obejmować CaMV35S. W jednym aspekcie, promotor może oznaczać indukowalny promotor. W jednym aspekcie, promotor może oznaczać specyficzny tkankowo promotor lub promotor regulowany środowiskowo lub regulowany rozwojowo. Zatem promotor może oznaczać, np. promotor specyficzny dla nasienia, specyficzny dla liścia, specyficzny dla korzenia, specyficzny dla łodygi lub promotor indukowany odcięciem. W jednym aspekcie, kaseta ekspresyjna może dodatkowo zawierać wektor ekspresyjny na bazie rośliny lub wirusa roślinnego. [0031] Wynalazek zapewnia nośniki do klonowania zawierający kasetę ekspresyjną (np. wektor) według wynalazku lub kwas nukleinowy według wynalazku. Nośnik do klonowania może oznaczać wektora wirusowego, plazmid, faga, fagemid, kosmid, fosmid, bakteriofaga lub sztuczny chromosom. Wektor wirusowy może zawierać wektor adenowirusowy, wektor retrowirusowy lub wektor wirusowy związany z adenowirusem. Nośnik do klonowania może zawierać bakteryjny sztuczny chromosom (BAC), plazmid, wektor pochodzący od bakteriofaga P1 (PAC), sztuczny chromosom drożdży (YAC), lub ssaczy sztuczny chromosom (MAC). [0032] Wynalazek zapewnia transformowaną komórkę zawierającą kwas nukleinowy według wynalazku lub kasetę ekspresyjną (np. wektor) według wynalazku, lub nośnik do klonowania według wynalazku. W jednym aspekcie transformowana komórka może oznaczać komórkę bakteryjną, komórkę ssaczą, komórkę grzyba, komórkę drożdżową, komórkę owadzią lub komórkę roślinną. W jednym aspekcie komórka roślinna może oznaczać komórkę ziemniaka, pszenicy, ryżu, kukurydzy, tytoniu lub jęczmienia. -10- [0033] Wynalazek zapewnia transgeniczne inne niż ludzie zwierzęta zawierające kwas nukleinowy według wynalazku lub kasetę ekspresyjną (np. wektor) według wynalazku. W jednym aspekcie zwierzę oznacza mysz, szczura, krowę, owcę, lub innego ssaka. [0034] Wynalazek zapewnia transgeniczne rośliny zawierające kwas nukleinowy według wynalazku lub kasetę ekspresyjną (np. wektor) według wynalazku. Transgeniczna roślina może oznaczać roślinę kukurydzy, roślinę ziemniaka, roślinę pomidora, roślinę pszenicy, roślinę oleistą, roślinę rzepaku, roślinę soi, roślinę ryżu, roślinę jęczmienia lub roślinę tytoniu. Wynalazek zapewnia transgeniczne nasiona zawierające kwas nukleinowy według wynalazku lub kasetę ekspresyjną (np. wektor) według wynalazku. Transgeniczne nasiona mogą oznaczać nasiono kukurydzy, ziarno pszenicy, nasiono oleiste, rzepak (roślina rzepaku canola), nasiono soi, ziarno palmy, nasiono słonecznika, nasiono sezamu, orzeszek ziemny, ryż lub nasiono roślin tytoniu. [0035] Ujawnienie zapewnia antysensowny oligonukleotyd zawierający sekwencję kwasu nukleinowego komplementarną do lub zdolną do hybrydyzowania w rygorystycznych warunkach do kwasu nukleinowego według ujawnienia. Ujawnienie zapewnia sposoby hamowania translacji informacji fosfolipazy w komórce, obejmujące podawanie komórce lub eksprymowanie w komórce antysensownego oligonukleotydu zawierającego sekwencję kwasu nukleinowego komplementarną do lub zdolną do hybrydyzowania w rygorystycznych warunkach do kwasu nukleinowego według wynalazku. [0036] Ujawnienie zapewnia oligonukleotyd antysensowny zawierający sekwencję kwasu nukleinowego komplementarną lub zdolną do hybrydyzacji w rygorystycznych warunkach do kwasu nukleinowego według wynalazku. Ujawnienie zapewnia sposoby hamowania translacji informacji fosfolipazy w komórce, obejmujący podawanie komórce lub ekspresję w komórce oligonukleotydu antysensownego zawierającego sekwencję kwasu nukleinowego komplementarną lub zdolną do hybrydyzacji w rygorystycznych warunkach do kwasu nukleinowego według wynalazku. Antysensowny oligonukleotyd może mieć pomiędzy około 10 do 50, około 20 do 60, około 30 do 70, około 40 do 80, około 60 do 100, około 70 do 110, lub około 80 do 120 zasad długości. [0037] Ujawnienie zapewnia sposoby hamowania translacji informacji fosfolipazy, np. fosfolipazy w komórce, obejmujący podawanie komórce lub ekspresję w komórce oligonukleotydu antysensownego zawierającego sekwencję kwasu nukleinowego komplementarną lub zdolną do hybrydyzacji w rygorystycznych warunkach do kwasu nukleinowego według wynalazku. Ujawnienie zapewnia dwuniciowe hamujące cząsteczki RNA (RNAi) obejmujące podsekwencje sekwencji według wynalazku. W jednym aspekcie, the RNAi ma około 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 lub więcej nukleotydów dupleksu długości. Ujawnienie zapewnia sposoby hamowania ekspresji fosfolipazy, np. fosfolipazy, w komórce, obejmujący podawanie komórce lub ekspresję w komórce dwuniciowego hamującego RNA (iRNA), przy czym RNA zawiera podsekwencję sekwencji według wynalazku. -11- [0038] Ujawnienie zapewnia wyizolowany lub rekombinowany polipeptyd zawierający sekwencję aminokwasową mającą co najmniej około 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, lub 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do przykładowego polipeptydu lub peptydu według ujawnienia (np. SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:74, SEQ ID NO:76, SEQ ID NO:78, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, SEQ ID NO:92, SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:102, SEQ ID NO:104, SEQ ID NO:106, SEQ ID NO:108 SEQ ID NO:110, SEQ ID NO:112, SEQ ID NO:114, SEQ ID NO:116, SEQ ID NO:118, SEQ ID NO:120 lub SEQ ID NO:122, SEQ ID NO:124, SEQ ID NO:126, SEQ ID NO:128, SEQ ID NO:130, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:136, SEQ ID NO:138; SEQ ID NO:140; SEQ ID NO:142; SEQ ID NO:144; NO:146, SEQ ID NO:148, SEQ ID NO:150, SEQ ID NO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ ID NO:168, SEQ ID NO:170, SEQ ID NO:172, lub SEQ ID NO:174) na regionie co najmniej około 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 400, 450, 500, 550 lub 600 lub więcej reszt, lub na całej długości polipeptydu; i, w jednym aspekcie, identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. [0039] W jednym aspekcie, ujawnienie zapewnia wyizolowany lub rekombinowany polipeptyd zawierający sekwencję aminokwasową mającą co najmniej około 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do SEQ ID NO:2. W jednym aspekcie, ujawnienie zapewnia wyizolowany lub rekombinowany polipeptyd zawierający sekwencję aminokwasową mającą co najmniej około 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do SEQ ID NO:4. W jednym aspekcie, ujawnienie zapewnia wyizolowany lub rekombinowany polipeptyd zawierający sekwencję aminokwasową mającą co najmniej około 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do SEQ ID NO:6. W jednym aspekcie, ujawnienie zapewnia wyizolowany lub rekombinowany polipeptyd zawierający sekwencję aminokwasową mającą co najmniej około 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, -12- 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do SEQ ID NO:8. [0040] Wynalazek zapewnia wyizolowane lub rekombinowane polipeptydy kodowane przez kwas nukleinowy według wynalazku. Polipeptyd może mieć sekwencję jak podano w SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:74, SEQ ID NO:76, SEQ ID NO:78, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, SEQ ID NO:92, SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:102, SEQ ID NO:104, SEQ ID NO:106, SEQ ID NO:108 SEQ ID NO:110, SEQ ID NO:112, SEQ ID NO:114, SEQ ID NO:116, SEQ ID NO:118, SEQ ID NO:120, SEQ ID NO:122, SEQ ID NO:124, SEQ ID NO:126, SEQ ID NO:128, SEQ ID NO:130, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:136, SEQ ID NO:138; SEQ ID NO:140; SEQ ID NO:142; SEQ ID NO:144; NO:146, SEQ ID NO:148, SEQ ID NO:150, SEQ ID NO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ ID NO:168, SEQ ID NO:170, SEQ ID NO:172, lub SEQ ID NO:174. Polipeptyd może mieć aktywność fosfolipazy, np. aktywność fosfolipazy A, B, C lub D, lub dowolną kombinację aktywności fosfolipazy, na przykład, aktywność PL A, PL C i/lub PL D - jako wielofunkcyjna aktywność. Na przykład, polipeptyd według ujawnienia jest aktywny enzymatycznie, ale bez aktywności lipazy, np. nie ma żadnej aktywności enzymatycznej, która wpływa na obojętną frakcję oleju (trójglicerydy). Ujawnienie zapewnia sposób odśluzowania obejmujący zastosowanie polipeptydu według wynalazku mającego aktywność fosfolipazy, ale nie aktywność lipazy, taki, że w sposobie odśluzowania jakakolwiek frakcja oleju obojętnego nie była naruszona (zmniejszona, zmieniona, zdegradowana, np. zhydrolizowana). [0041] Ujawnienie zapewnia wyizolowane lub rekombinowane polipeptydy zawierające polipeptyd według ujawnienia bez sekwencji sygnałowej. Polipeptyd według niniejszego ujawnienia bez sekwencji sygnałowej może mieć co najmniej 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% lub więcej identyczności sekwencji do reszt 30 do 287 z SEQ ID NO:2, sekwencji aminokwasowej mającej co najmniej 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do reszt 25 do 283 z SEQ ID NO:4, sekwencji aminokwasowej mającej co najmniej 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do reszt 26 do 280 z SEQ ID NO:6, lub, sekwencji aminokwasowej mającej co najmniej 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, -13- 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do reszt 40 do 330 z SEQ ID NO:8. Identyczności sekwencji można określić przez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. [0042] Ujawnienie zapewnia wyizolowany lub rekombinowany polipeptyd lub peptyd zawierający co najmniej 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 lub 100 lub więcej kolejnych zasad sekwencji polipeptydu lub peptydu według ujawnienia, sekwencje zasadniczo identyczne do nich, oraz sekwencje do nich komplementarne. Peptydem może być, np. fragment immunogenny, motyw (np. miejsce wiążące) lub miejsce aktywne. [0043] W jednym aspekcie, wyizolowany lub rekombinowany polipeptyd według wynalazku (z lub bez sekwencji sygnałowej) ma aktywność fosfolipazy. W jednym aspekcie, aktywność fosfolipazy obejmuje katalizowanie hydrolizy wiązania estrowego glicerol-fosforan (tj. przecinanie wiązań estrowych glicerolofosforanu). Aktywność fosfolipazy może obejmować katalizowanie hydrolizy wiązania estrowego w fosfolipidzie w oleju roślinnym. Fosfolipid oleju roślinnego może obejmować fosfolipid nasion oleistych. Aktywność fosfolipazy może obejmować aktywność fosfolipazy C (PLC); aktywność fosfolipazy A (PLA) taką, jak aktywność fosfolipazy A1 lub fosfolipazy A2; aktywność fosfolipazy D (PLD) taką, jak aktywność fosfolipazy D1 lub fosfolipazy D2; aktywność fosfolipazy B (PLB), np. aktywność fosfolipazy i lizofosfolipazy (LPL) lub aktywność fosfolipazy i aktywność lizofosfolipazytransacylazy (LPTA) lub aktywność fosfolipazy, lizofosfolipazy (LPL) i lizofosfolipazytransacylazy (LPTA); lub aktywność patatyny, lub ich kombinację. Na przykład, w jednym aspekcie, fosfolipaza zawiera kombinację jednej lub więcej opisanych tu aktywności enzymu, na przykład, fosfolipaza może mieć aktywność PLC i PLA; aktywność PLB i PLA; aktywność PLC i PLD; aktywność PLC i PLB; aktywność PLB i patatyny; aktywność PLC i patatyny; aktywność PLD i PLA; aktywność PLD, PLA, PLB i PLC; lub aktywność PLD, PLA, PLB, PLC i patatyny; lub, aktywność fosfolipazy i lizofosfolipazy (LPL) lub aktywność fosfolipazy i lizofosfolipazy-transacylazy (LPTA) lub aktywność fosfolipazy i lizofosfolipazy (LPL) oraz aktywność lizofosfolipazy-transacylazy (LPTA) lub dowolne ich kombinacje. [0044] Aktywność fosfolipazy może obejmować hydrolizę glikoproteiny, np. jak glikoproteiny znajdywanej w bulwie ziemniaka. Aktywność fosfolipazy może obejmować aktywność enzymatyczną patatyny. Aktywność fosfolipazy może obejmować aktywność hydrolazy acylolipidowej (LAH). [0045] Aktywność fosfolipazy może być termostabilna. Polipeptyd może zachować aktywność fosfolipazy w warunkach obejmujących zakres temperatur pomiędzy około 20 do około 30°C, pomiędzy około 25°C do około 40°C, pomiędzy około 37°C do około 95°C, pomiędzy około 55°C do około 85°C, pomiędzy około 70°C do około 95°C, or pomiędzy około 90°C do około 95°C. W innym aspekcie, aktywność fosfolipazy może być termotolerancyjna. Polipeptyd może zachować aktywność fosfolipazy po ekspozycji do temperatury w zakresie od więcej niż 37°C do około 95°C, lub w zakresie od więcej niż 55°C -14- do około 85°C. W jednym aspekcie, polipeptyd może zachować aktywność fosfolipazy po ekspozycji do temperatury w zakresie od więcej niż 90°C do około 95°C w pH 4,5. [0046] Alternatywnie polipeptyd może zachować aktywność fosfolipazy w warunkach zawierających około pH 6,5, pH 6, pH 5,5, pH 5, pH 4,5 lub pH 4 lub mniej (bardziej kwasowy). W jednym aspekcie, polipeptyd może zachować aktywność fosfolipazy w warunkach zawierających około pH 7, pH 7,5 pH 8,0, pH 8,5, pH 9, pH 9,5, pH 10, pH 10,5 lub pH 11 lub więcej (bardziej zasadowy). [0047] W jednym aspekcie, wyizolowany lub rekombinowany polipeptyd może zawierać polipeptyd według wynalazku, który jest pozbawiony sekwencji sygnałowej. W jednym aspekcie wyizolowany lub rekombinowany polipeptyd może obejmować polipeptyd według wynalazku zawierający heterologiczną sekwencję sygnałową taką, jak heterologiczna sekwencja sygnałowa fosfolipazy lub inna niż fosfolipazy. [0048] Ujawnienie zapewnia wyizolowane lub rekombinowane peptydy zawierające sekwencję aminokwasową mającą co najmniej 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do reszt 1 do 29 z SEQ ID NO:2, co najmniej 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do reszt 1 do 24 z SEQ ID NO:4, co najmniej 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do reszt 1 do 25 z SEQ ID NO:6, lub co najmniej 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do reszt 1 do 39 z SEQ ID NO:8, i do innych sekwencji sygnałowych jak podano na liście SEQ ID, przy czym identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. Peptydy te mogą działać jako sekwencje sygnałowe na endogennej fosfolipazie, na innej fosfolipazie albo białko heterologiczne (enzym inny niż fosfolipaza lub inne białko). W jednym aspekcie, ujawnienie zapewnia białka chimeryczne zawierające pierwszą domenę zawierającą sekwencję sygnałową według ujawnienia i co najmniej drugą domenę. Białko może być białkiem fuzyjnym. Druga domena może zawierać enzym. Enzym może być fosfolipazą. [0049] Ujawnienie zapewnia polipeptydy chimeryczne zawierające co najmniej pierwszą domenę zawierającą peptyd sygnałowy (SP) według ujawnienia lub domenę katalityczną (CD), lub miejsce aktywne fosfolipazy według ujawnienia i co najmniej drugą domenę zawierającą heterologiczny polipeptyd lub peptyd, w którym heterologiczny polipeptyd lub peptyd nie jest naturalnie powiązany z peptydem sygnałowym (SP) lub domeną katalityczną (CD). W jednym aspekcie, heterologiczny polipeptyd lub peptyd nie oznacza fosfolipazy. Heterologiczny polipeptyd lub peptyd mogą znajdować się przy końcu aminowym, przy końcu karboksylowym lub na obu końcach peptydu sygnałowego (SP) lub domeny katalitycznej (CD). [0050] Ujawnienie zapewnia wyizolowane lub rekombinowane kwasy nukleinowe kodujące chimeryczny polipeptyd, w którym chimeryczny polipeptyd zawiera co najmniej pierwszą domenę zawierającą peptyd sygnałowy (SP) lub domenę katalityczną (CD), lub miejsce aktywne polipeptydu według ujawnienia, i co najmniej drugą domenę zawierającą -15- heterologiczny polipeptyd lub peptyd, w którym heterologiczny polipeptyd lub peptyd nie jest naturalnie powiązany z peptydem sygnałowym (SP) lub domeną katalityczną (CD). [0051] Aktywność fosfolipazy może obejmować aktywność specyficzną w około 37°C w zakresie od około 10 jednostek na miligram do około 100 jednostek na miligram białka. W innym aspekcie, aktywność fosfolipazy obejmuje aktywność specyficzną od około 100 jednostek na miligram do około 1000 jednostek na miligram, od około 500 jednostek na miligram do około 750 jednostek na miligram białka. Alternatywnie, aktywność fosfolipazy obejmuje aktywność specyficzną w 37°C w zakresie od około 100 do około 500 jednostek na miligram białka. W jednym aspekcie, aktywność fosfolipazy obejmuje aktywność specyficzną w 37°C w zakresie od około 500 do około 1200 jednostek na miligram białka. W innym aspekcie, aktywność fosfolipazy obejmuje aktywność specyficzną w 37°C w zakresie od około 750 do około 1000 jednostek na miligram białka. W innym aspekcie, termotolerancja obejmuje zachowywanie co najmniej połowy aktywności specyficznej fosfolipazy w 37°C po ogrzaniu do podwyższonej temperatury. Alternatywnie termotolerancja może obejmować zachowywanie aktywności specyficznej w 37°C w zakresie od około 500 do około 1200 jednostek na miligram białka po ogrzaniu do podwyższonej temperatury. [0052] Wynalazek zapewnia wyizolowany lub rekombinowany polipeptyd według wynalazku, w którym polipeptyd zawiera co najmniej jedno miejsce glikozylacji. W jednym aspekcie glikozylacja może oznaczać N-glikozylację. W jednym aspekcie polipeptyd może być glikozylowany po eksprymowaniu w P. pastoris lub S. combe. [0053] Wynalazek zapewnia enzymy fosfolipazy i kodujące je kwasy nukleinowe, mające sekwencję dowolnej z przykładowych fosfolipaz według wynalazku ze zmienionym jednym lub więcej lub wszystkimi miejscami glikozylacji, jak omówiono powyżej. Zatem wynalazek zapewnia sposoby wytwarzania wariantu sekwencji kodujących fosfolipazę o podwyższonej ekspresji w komórce gospodarza, przy czym sposób obejmuje modyfikowanie sekwencji kodującej fosfolipazę według wynalazku tak, że jedno, kilka lub wszystkie motywy kodujące miejsce N-glikozylacji są modyfikowane do motywu nieglikozylowanego. Wynalazek zapewnia również sekwencję kodującą fosfolipazę otrzymaną tym sposobem, i enzymy, które kodują. [0054] Wynalazek zapewnia sposoby wytwarzania sekwencji kodującej wariant fosfolipazy kodującej fosfolipazę o zwiększonej odporności na proteazę obejmujące modyfikowanie odpowiednika aminokwasu w pozycji 131 z SEQ ID NO:2 jednej, kilku lub wszystkich z następujących reszt: Lizyna (K); Seryna (S); Glicyna (G); Arginina (R); Glutamina (Q); Alanina (A); Izoleucyna (I); Histydyna (H); Fenyloalanina (F); Treonina (T); Metionina (M) Leucyna (L), w tym wariantów do SEQ ID NO:2 (i kwasu nukleinowego, który je koduje) mające te przykładowe modyfikacje. Wynalazek zapewnia także izolowane, syntetyczne lub rekombinowane fosfolipazy kodowane przez sekwencję wykonaną tym sposobem. [0055] Wynalazek zapewnia sposoby wytwarzania sekwencji kodującej wariant fosfolipazy kodujący fosfolipazę o zmniejszonej odporności na proteazę obejmujące modyfikowanie odpowiednika aminokwasu w pozycji 131 z SEQ ID NO:2 jednej, kilku lub wszystkich z -16- następujących reszt: Tryptofan (W); Glutaminian (E); Tyrozyna (Y), w tym warianty do SEQ ID NO:2 (i kwasu nukleinowego, który je koduje) mające te przykładowe modyfikacje. Wynalazek zapewnia także izolowane, syntetyczne lub rekombinowane fosfolipazy kodowane przez sekwencję wykonaną tym sposobem. [0056] Ujawnienie zapewnia preparaty białkowe zawierające polipeptyd według ujawnienia, w którym preparat białkowy zawiera ciecz, ciało stałe lub żel. [0057] Ujawnienie zapewnia heterodimery zawierające polipeptyd według wynalazku i drugie białko lub domenę. Drugi człon heterodimeru może oznaczać inną fosfolipazę, inny enzym lub inne białko. W jednym aspekcie, druga domena może oznaczać polipeptyd, a heterodimer może oznaczać białko fuzyjne. W jednym aspekcie, druga domena może oznaczać epitop lub znacznik. W jednym aspekcie, ujawnienie zapewnia homodimery zawierające polipeptyd według ujawnienia. [0058] Ujawnienie zapewnia unieruchomione polipeptydy mające aktywność fosfolipazy, przy czym polipeptyd obejmuje polipeptyd według wynalazku, polipeptyd kodowany przez kwas nukleinowy według wynalazku, lub polipeptyd zawierający polipeptyd według ujawnienia i drugą domenę (np. białko fuzyjne). W jednym aspekcie, polipeptyd według ujawnienia jest unieruchomiony na komórce, pęcherzyku, liposomie, warstewce, błonie, metalu, żywicy, polimerze, ceramice, szkle, mikroelektrodzie, cząstce grafitowej, kulce, żelu, płytce, kryształach, tabletce, pigułce, kapsułce, proszku, aglomeracie, powierzchni, porowatej strukturze, macierzy lub probówce kapilarnej. W jednym aspekcie, polipeptyd według ujawnienia jest unieruchomiony na materiałach takich, jak ziarna, plewy, kora, skóra, włosy, szkliwo, kość, skorupa i pochodzących od nich materiałach, lub materiałach paszy dla zwierząt, lub ich kombinacjach. [0059] Polipeptydy według wynalazku (np. fosfolipazy) mogą być również obecne samodzielnie lub jako mieszanina fosfolipaz lub fosfolipaz i innych enzymów hydrolitycznych takich, jak celulazy, ksylanazy, proteazy, lipazy, białko heterologiczne, lub enzymy redoks takie, jak lakkazy, peroksydazy, katalazy, oksydazy lub reduktazy. Mogą być one formułowane w postaci stałej takiej, jak proszek, preparaty liofilizowane, granulki, tabletki, kostki, kryształy, kapsułki, pigułki, peletki, lub w postaci ciekłej takiej, jak roztwór wodny, aerozol, żel, pasta, gęsta zawiesina, emulsja woda/olej, krem, kapsułka, zawiesina pęcherzykowa lub micelarna. W jednym aspekcie, te formulacje według ujawnienia mogą zawierać dowolne z lub kombinację poniższych składników: poliolu takie, jak glikole polietylenowe, alkohole poliwinylowe, glicerol, cukry takie, jak sacharoza, sorbitol, trehaloza, glukoza, fruktoza, maltoza, środki żelujące takie, jak gumy guar, karageniany, alginiany, dekstrany, pochodne celulozowe, pektyny, sole takie, jak chlorek sodu, siarczan sodu, siarczan amonu, chlorek wapnia, chlorek magnezu, chlorek cynku, siarczan cynku, sole kwasów tłuszczowych i ich pochodne, chelatory metalu takie, jak EDTA, EGTA, cytrynian sodu, środki przeciwbakteryjne takie, jak kwasy tłuszczowe, ich pochodne, parabeny, sorbaty, benzoesany, dodatkowo można dodawać związki do blokowania wpływu proteaz takie, jak białka wypełniacze takie, jak BSA, hydrolizaty pszenicy, związki boranowe, emulgatory takie, jak detergenty niejonowe i jonowe, które można stosować samodzielnie lub w -17- kombinacji, fitosterole, witaminy, aminokwasy, środki redukujące takie, jak cysteina lub związki przeciwutleniaczy takie, jak kwas askorbinowy, jak również środki dyspergujące. [0060] W jednym aspekcie, sieciowanie i modyfikacja białka takie, jak pegylowanie, modyfikacja kwasem tłuszczowym i glikozylacja, stosuje się do poprawy stabilności polipeptydu według ujawnienia (np. stabilność enzymu). W jednym aspekcie, poliole i/lub cukry stanowią od około 5% do około 60%, lub więcej, formulacji, od około 10% do około 50% formulacji, od około 20% do około 40% formulacji, lub od około 5% do około 20% formulacji. W innym aspekcie, środki żelujące stanowią od około 0,5% do około 10% formulacji, od około 1% do około 8% formulacji, od około 2% do około 5% formulacji, lub od około 0,5% do około 3% formulacji. W innym aspekcie, sole takie, jak chlorek sodu, siarczan sodu, siarczan amonu, chlorek wapnia i/lub chlorek magnezu stanowią od około 1% do około 30% formulacji, od około 2% do około 20% formulacji, od około 5% do około 15% formulacji, lub od około 1% do około 10% formulacji. W innym aspekcie, chlorek cynku jest obecny w formulacji w stężeniu obejmującym od około 0,1 mM do około 20 mM, od około 0,5 mM do około 10 mM, od około 1 mM do około 5 mM, lub od około 0,1 mM do około 5 mM). W jeszcze innym aspekcie, siarczan cynku jest obecny w formulacji w stężeniach obejmujących od około 0,1 mM do około 20 mM, od około 0,5 mM do około 10 mM, od około 1 mM do około 5 mM, lub od około 0,1 mM do około 5 mM). W innym aspekcie, sole kwasów tłuszczowych i/lub ich pochodnych stanowią od około 5% do około 40% formulacji, od około 10% do około 30% formulacji, od około 15% do około 25% formulacji, lub od około 5% do około 20% formulacji. W innym aspekcie, środki chelatujące metale takie, jak EDTA, EGTA, i/lub cytrynian sodu są obecne w formulacji w stężeniach obejmujących od 0,1 mM do około 10 mM), od około 0,5 mM do około 8 mM, od około 1 mM do około 5 mM, lub od około 0,1 mM do około 1 mM. W innym aspekcie, środki przeciwbakteryjne takie, jak parabeny, sorbiniany, i/lub benzoesany stanowią od około 0,01% do około 10% formulacji, od około 0,05% do około 5% formulacji, od około 0,1% do około 1% formulacji, lub od około 0,05% do około 0,5% formulacji. W jeszcze innym aspekcie, białka wypełniające takie, jak BSA i/lub hydrolizaty pszenicy stanowią od około 1% do około 20% formulacji, od około 5% do około 15% formulacji, od około 2,5% do około 7,5% formulacji, lub od około 1% do około 5% formulacji. W innym aspekcie, emulgatory takie, jak niejonowe i/lub jonowe detergenty są obecne w formulacji w stężeniach obejmujących od około 1X krytyczne stężenie micelarne (CMC) do około 10X CMC, od około 2,5X CMC do około 7,5X CMC, od około 1X CMC do około 5X CMC, lub od około 3X CMC do około 6X CMC. W innym aspekcie, witaminy, aminokwasy, środki redukujące i/lub związki przeciwutleniające stanowią od około 0,1% do około 5% formulacji, od około 0,5% do około 4% formulacji, od około 1% do około 2,5% formulacji, lub od około 0,1% do około 1% formulacji. [0061] Ujawnienie zapewnia macierze, zawierające unieruchomiony polipeptyd, przy czym polipeptyd jest fosfolipazą według wynalazku lub jest polipeptydem kodowanym przez kwas nukleinowy według wynalazku. Ujawnienie zapewnia macierze zawierające unieruchomiony kwas nukleinowy według wynalazku. Ujawnienie zapewnia macierz zawierającą unieruchomione przeciwciało według ujawnienia. -18- [0062] Ujawnienie zapewnia wyizolowane lub rekombinowane przeciwciała, które specyficznie wiążą się z polipeptydem według wynalazku lub polipeptydem kodowanym przez kwas nukleinowy według wynalazku. Przeciwciało może oznaczać przeciwciało monoklonalne lub poliklonalne. Ujawnienie zapewnia hybrydomy zawierające przeciwciało według ujawnienia. [0063] Ujawnienie zapewnia sposoby do izolowania lub identyfikowania polipeptydu o aktywności fosfolipazy, obejmujące etapy: (a) zapewniania przeciwciała według ujawnienia (b) zapewniania próbki zawierającej polipeptydy; oraz (c) kontaktowania próbki z etapu (b) z przeciwciałem z etapu (a) w warunkach, w którym przeciwciało może się specyficznie wiązać z polipeptydem, tym samym izolowanie lub identyfikowanie fosfolipazy. Ujawnienie zapewnia sposoby wytwarzania przeciwciała przeciwko fosfolipazie, obejmujące podawanie zwierzęciu innemu niż człowiek kwasu nukleinowego według ujawnienia, lub polipeptydu według wynalazku, w ilości wystarczającej do wygenerowania humoralnej odpowiedzi immunologicznej, tym samym wytworzenia przeciwciała przeciwko fosfolipazie. [0064] Wynalazek zapewnia sposoby wytwarzania rekombinowanego polipeptydu, obejmujące etapy: (a) zapewniania kwasu nukleinowego według wynalazku funkcjonalnie połączonego do promotora; oraz, (b) eksprymowanie kwasu nukleinowego z etapu (a) w warunkach, które umożliwiają ekspresję polipeptydu, tym samym wytwarzanie rekombinowanego polipeptydu. Kwas nukleinowy może zawierać sekwencję mającą co najmniej 85% identyczności sekwencji do SEQ ID NO:1 na regionie co najmniej około 100 reszt, mającej co najmniej 80% identyczności sekwencji do SEQ ID NO:3 na regionie co najmniej około 100 reszt, mającej co najmniej 80% identyczności sekwencji do SEQ ID NO:5 na regionie co najmniej około 100 reszt, lub mającej co najmniej 70% identyczności sekwencji do SEQ ID NO:7 na regionie co najmniej około 100 reszt, przy czym identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. Kwas nukleinowy może zawierać kwas nukleinowy, który hybrydyzuje w warunkach rygorystycznych do kwasu nukleinowego jak podano w SEQ ID NO:1, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:3, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:5, lub jej podsekwencji; lub, sekwencji jak podano w SEQ ID NO:7, lub jej podsekwencji. Sposób może dodatkowo obejmować transformowanie komórki gospodarza kwasem nukleinowym z etapu (a) a następnie eksprymowanie kwasu nukleinowego z etapu (a), tym samym wytwarzanie rekombinowanego polipeptydu w transformowanej komórce. Sposób może dodatkowo obejmować wprowadzanie do gospodarza ? zwierzęcia różnego od człowieka kwasu nukleinowego z etapu (a) a następnie eksprymowanie kwasu nukleinowego z etapu (a), tym samym wytwarzanie rekombinowanego polipeptydu w gospodarzu zwierzęciu innym niż człowiek. [0065] Ujawnienie zapewnia sposoby identyfikowania polipeptydu mającego aktywność fosfolipazy, obejmujące poniższe etapy: (a) zapewniania polipeptydu według ujawnienia lub polipeptydu kodowanego przez kwas nukleinowy według ujawnienia, lub ich fragmentu lub wariantu, (b) zapewniania substratu fosfolipazy; oraz (c) kontaktowania polipeptyd lub jego fragmentu lub wariantu z etapu (a) z substratem z etapu (b) i wykrywania wzrostu ilości -19- substratu lub spadku ilości produktu reakcji, w którym spadek ilości substratu lub wzrost ilości produktu reakcji wykrywa polipeptyd mający aktywność fosfolipazy. W alternatywnych aspektach, kwas nukleinowy zawiera sekwencję mającą co najmniej 85% identyczności sekwencji do SEQ ID NO:1 na regionie co najmniej około 100 reszt, mającej co najmniej 80% identyczności sekwencji do SEQ ID NO:3 na regionie co najmniej około 100 reszt, mającej co najmniej 80% identyczności sekwencji do SEQ ID NO:5 na regionie co najmniej około 100 reszt, lub mającej co najmniej 70% identyczności sekwencji do SEQ ID NO:7 na regionie co najmniej około 100 reszt, przy czym identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. W alternatywnych aspektach kwas nukleinowy hybrydyzuje w rygorystycznych warunkach sekwencji jak podano w SEQ ID NO:1, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:3, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:5, lub jej podsekwencji; lub, sekwencji jak podano w SEQ ID NO:7, lub jej podsekwencji. [0066] Ujawnienie zapewnia sposoby identyfikacji substratu fosfolipazy obejmujące następujące etapy: (a) zapewniania polipeptydu według ujawnienia lub polipeptydu kodowanego przez kwas nukleinowy według ujawnienia; (b) zapewniania substratu testowego; i, (c) kontaktowania polipeptydu z etapu (a) z substratem testowym z etapu (b) i wykrywania wzrostu w ilości substratu lub zmniejszenie ilości produktu reakcji, przy czym spadek ilości substratu lub zwiększenie ilości produktu reakcji identyfikuje substrat testowy jako substrat fosfolipazy. W alternatywnych aspektach, kwasu nukleinowy może mieć co najmniej 85% identyczności sekwencji do SEQ ID NO:1 na regionie co najmniej około 100 reszt, co najmniej 80% identyczności sekwencji do SEQ ID NO:3 na regionie co najmniej około 100 reszt, co najmniej 80% identyczności sekwencji do SEQ ID NO:5 na regionie co najmniej około 100 reszt, lub, co najmniej 70% identyczności sekwencji do SEQ ID NO:7 na regionie co najmniej około 100 reszt, przy czym identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. W alternatywnych aspektach, kwas nukleinowy hybrydyzuje w rygorystycznych warunkach do sekwencji jak podano w SEQ ID NO:1, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:3, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:5, lub jej podsekwencji; lub, sekwencji jak podano w SEQ ID NO:7, lub jej podsekwencji. [0067] Ujawnienie zapewnia sposoby określania, czy związek wiąże się specyficznie z fosfolipazą obejmujące następujące etapy: (a) ekspresji kwasu nukleinowego lub wektora zawierającego kwas nukleinowy w warunkach pozwalających na translację kwasu nukleinowego do polipeptydu, przy czym kwas nukleinowy i wektor zawierają kwas nukleinowy lub wektor według ujawnienia; lub, zapewnienie polipeptydu według ujawnienia (b) kontaktowania polipeptydu ze związkiem testowym; i, (c) określania, czy związek testowy specyficznie wiąże się z polipeptydem, określając tym, że związek wiąże się specyficznie z fosfolipazą. W alternatywnych aspektach, sekwencja kwasu nukleinowego ma co najmniej 85% identyczności sekwencji do SEQ ID NO:1 na regionie co najmniej około 100 reszt, co najmniej 80% identyczności sekwencji do SEQ ID NO:3 na regionie co najmniej około 100 reszt, co najmniej 80% identyczności sekwencji do SEQ ID NO:5 na regionie co najmniej około 100 reszt, lub, co najmniej 70% identyczności sekwencji do SEQ ID NO:7 na regionie -20- co najmniej około 100 reszt, przy czym identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. W alternatywnych aspektach, kwas nukleinowy hybrydyzuje w rygorystycznych warunkach do sekwencji jak podano w SEQ ID NO:1, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:3, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:5, lub jej podsekwencji; lub, sekwencji jak podano w SEQ ID NO:7, lub jej podsekwencji. [0068] Ujawnienie zapewnia sposoby identyfikacji modulatora aktywności fosfolipazy obejmujące następujące etapy: (a) zapewniania polipeptydu według ujawnienia lub polipeptydu kodowanego przez kwas nukleinowy według ujawnienia; (b) zapewniania związku testowego; (c) kontaktowania polipeptydu z etapu (a) ze związkiem testowym z etapu (b); i, pomiar aktywności fosfolipazy, przy czym zmiana aktywności fosfolipazy mierzona w obecności związku testowego w porównaniu z aktywnością w nieobecności związku testowego zapewnia ustalenie, że związek testowy moduluje aktywność fosfolipazy. W alternatywnych aspektach, kwasu nukleinowy może mieć co najmniej 85% identyczności sekwencji do SEQ ID NO:1 na regionie co najmniej około 100 reszt, co najmniej 80% identyczności sekwencji do SEQ ID NO:3 na regionie co najmniej około 100 reszt, co najmniej 80% identyczności sekwencji do SEQ ID NO:5 na regionie co najmniej około 100 reszt, lub, co najmniej 70% identyczności sekwencji do SEQ ID NO:7 na regionie co najmniej około 100 reszt, przy czym identyczności sekwencji określa się poprzez analizę algorytmem porównywania sekwencji lub przez kontrolę wizualną. W alternatywnych aspektach, kwas nukleinowy może hybrydyzować w rygorystycznych warunkach do sekwencji kwasu nukleinowego wybranej z grupy składającej się z sekwencji jak podano w SEQ ID NO:1, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:3, lub jej podsekwencji; sekwencji jak podano w SEQ ID NO:5, lub jej podsekwencji; i, sekwencji jak podano w SEQ ID NO:7, lub jej podsekwencji. [0069] W jednym aspekcie, aktywność fosfolipazy mierzy się przez zapewnienie substratu fosfolipazy i wykrywanie wzrostu ilości substratu lub zmniejszenia ilości produktu reakcji. Zmniejszenie ilości substratu lub wzrost ilości produktu reakcji ze związkiem testowym w stosunku do ilości substratu lub produktu reakcji bez związku testowego identyfikuje związek testowy jako aktywator aktywności fosfolipazy. Wzrost ilości substratu lub zmniejszenie ilości produktu reakcji ze związkiem testowym w stosunku do ilości substratu lub produktu reakcji bez związku testowego identyfikuje związek testowy jako inhibitor aktywności fosfolipazy. [0070] Ujawnienie zapewnia systemy komputerowe zawierające procesor i urządzenie do przechowywania danych, w którym wymieniony urządzenie do przechowywania danych ma zapisaną w swojej pamięci sekwencję polipeptydu według wynalazku w opisie lub sekwencję kwasu nukleinowego według wynalazku. [0071] System komputerowy może dodatkowo zawierać algorytm do porównywania sekwencji i urządzenie do przechowywania danych, mające zapisaną w swojej pamięci co najmniej jedną sekwencję referencyjną. Algorytm do porównywania sekwencji może zawierać program komputerowy, który wskazuje polimorfizmy. System komputerowy może -21- dodatkowo zawierać identyfikator, który identyfikuje jedną lub więcej cech w wymienionej sekwencji. [0072] Ujawnienie zapewnia nośniki odczytywalne komputerowo, mające zapisaną w swojej pamięci sekwencję obejmującą sekwencję polipeptydu według wynalazku lub sekwencję kwasu nukleinowego według wynalazku. [0073] Ujawnienie zapewnia sposoby identyfikowania cechy w sekwencji, obejmujące etapy: (a) odczytywania sekwencji przy użyciu programu komputerowego, który identyfikuje jedną lub więcej cech w sekwencji, przy czym sekwencja obejmuje sekwencję polipeptydu według wynalazku lub sekwencję kwasu nukleinowego według wynalazku; oraz (b) identyfikowania jednej lub więcej cech w sekwencji za pomocą programu komputerowego. [0074] Ujawnienie zapewnia sposoby porównywania pierwszej sekwencji do drugiej sekwencji, obejmujące etapy: (a) odczytywania pierwszej sekwencji i drugiej sekwencji poprzez stosowanie programu komputerowego, który porównuje sekwencje, w którym pierwsza sekwencja obejmuje sekwencję polipeptydu według wynalazku lub sekwencję kwasu nukleinowego według wynalazku; oraz, (b) określania różnic pomiędzy pierwszą sekwencją i drugą sekwencją za pomocą programu komputerowego. W jednym aspekcie, etap określania różnic pomiędzy pierwszą sekwencją i drugą sekwencją zawiera dodatkowo etap identyfikowania polimorfizmów. W jednym aspekcie, sposób dodatkowo obejmuje identyfikator (i stosowanie identyfikatora), który identyfikuje jedną lub więcej cech w sekwencji. W jednym aspekcie, sposób obejmuje odczytywanie pierwszej sekwencji przy użyciu programu komputerowego i identyfikowanie jednej lub więcej cech w sekwencji. [0075] Ujawnienie zapewnia sposoby izolowania lub odzyskiwania kwasu nukleinowego kodującego polipeptyd o aktywności fosfolipazy z próbki środowiskowej obejmujący etapy: (a) zapewniania pary sekwencji starterów do amplifikacji dla amplifikacji kwasu nukleinowego kodującego polipeptyd o aktywności fosfolipazy, przy czym para starterów jest zdolna do amplifikacji kwasu nukleinowego według ujawnienia (np. SEQ ID NO:1, lub jej podsekwencji; SEQ ID NO:3, lub jej podsekwencji; SEQ ID NO:5, lub jej podsekwencji; lub SEQ ID NO:7, lub jej podsekwencji, etc.); (b) izolowania kwasu nukleinowego z próbki środowiskowej lub traktowanie próbki środowiskowej tak, że kwas nukleinowy w próbce jest dostępny dla hybrydyzacji do pary starterów do amplifikacji; i, (c) łączenia kwasu nukleinowego z etapu (b) z parą starterów do amplifikacji z etapu (a) i amplifikowania kwasu nukleinowego z próbki środowiskowej, izolując lub odzyskując w ten sposób kwas nukleinowy kodujący polipeptyd o aktywności fosfolipazy z próbki środowiskowej. W jednym aspekcie, każdy element pary sekwencji starterów do amplifikacji zawiera oligonukleotyd zawierający co najmniej około 10 do 50 kolejnych zasad sekwencji kwasu nukleinowego według ujawnienia. W jednym aspekcie, para sekwencji starterów do amplifikacji jest parą do amplifikacji według ujawnienia. [0076] Ujawnienie zapewnia sposoby izolowania lub odzyskiwania kwasu nukleinowego kodującego polipeptyd o aktywności fosfolipazy z próbki środowiskowej obejmujący etapy: (a) zapewniania sondy polinukleotydowej zawierającej sekwencję kwasu nukleinowego -22- według ujawnienia, lub jej podsekwencji; (b) izolowania kwasu nukleinowego z próbki środowiskowej lub traktowanie próbki środowiskowej tak, że kwas nukleinowy w próbce jest dostępny dla hybrydyzacji do sondy polinukleotydowej z etapu (a); (c) łączenia izolowanego kwasu nukleinowego lub traktowanie próbki środowiskowej z etapu (b) sondą polinukleotydową z etapu (a); i, (d) izolowania kwasu nukleinowego, który hybrydyzuje specyficznie z sondą polinukleotydową z etapu (a), izolując lub odzyskując w ten sposób kwas nukleinowy kodujący polipeptyd o aktywności fosfolipazy z próbki środowiskowej. W alternatywnych aspektach, the próbka środowiskowa obejmuje próbkę wody, próbkę ciekłą, próbkę gleby, próbkę powietrza lub próbkę biologiczną. W alternatywnych aspektach, próbka biologiczna pochodzi z komórki bakteryjnej, komórki pierwotniakowej, komórki owadziej, komórki drożdżowej, komórki roślinnej, komórki grzybowej i komórki glonów (alg), porostów, lub komórki ssaczej. [0077] Ujawnienie zapewnia sposoby generowania wariantu kwasu nukleinowego kodującego fosfolipazę, obejmujące etapy: (a) zapewniania matrycy kwasu nukleinowego obejmującej kwas nukleinowy według ujawnienia; (b) modyfikowania, usuwania lub dodawania jednego lub więcej nukleotydów w sekwencji matrycy, lub ich kombinację, w celu wygenerowania wariantu matrycy kwasu nukleinowego. [0078] Sposób może dodatkowo obejmować eksprymowanie wariantu kwasu nukleinowego, w celu wygenerowania wariantu polipeptydu fosfolipazy. W jednym aspekcie, modyfikacje, addycje lub delecje są wprowadzane przez podatny na błędy PCR, tasowanie, kierowaną oligonukleotydami mutagenezę, PCR typu składanie (ang. assembly PCR), mutagenezę za pomocą PCR ?seksualnego? [z symulowaniem wyniku rekombinacji genetycznej, ang. sexual PCR mutagenesis], mutagenezę in vivo, mutagenezę kasetową, rekursywną mutagenezę zespołową [ang. recursive ensemble mutagenesis], wykładniczą mutagenezę zespołową [ang. exponential ensemble mutagenesis], mutagenezę miejscowo specyficzną, ponowne składanie genów [ang. gene reassembly], mutagenezę nasyceniową miejsc genowych (Gene Site Saturation Mutagenesis?, GSSM?), ponowne składanie syntetyczne z udziałem ligacji (SLR; ang. synthetic ligation reassembly) i/lub ich kombinację. W alternatywnych aspektach, modyfikacje, addycje lub delecje są wprowadzane poprzez sposób wybrany z grupy składającej się z rekombinacji, rekursywnej rekombinacji sekwencji, modyfikowanej tiofosforanem mutagenezy DNA, mutagenezy zawierającej matrycę uracylową, mutagenezy dupleksu z lukami, mutagenezy naprawczej punktowych niedopasowań, mutagenezy szczepu gospodarza niezdolnego do napraw, mutagenezy chemicznej, mutagenezy radiogenicznej, mutagenezy delecyjnej, mutagenezy restrykcyjno-selekcyjnej, mutagenezy restrykcyjnooczyszczającej, syntezy sztucznych genów, mutagenezy zespołowej, tworzenia multimerów chimerycznego kwasu nukleinowego i/lub ich kombinacji. [0079] Sposób można iteracyjnie powtarzać do momentu wyprodukowania fosfolipazy mającej zmienioną lub inną aktywność lub zmienioną lub inną stabilność niż fosfolipaza kodowana przez matrycę kwasu nukleinowego. W jednym aspekcie, zmieniona lub inna aktywność oznacza aktywność fosfolipazy w warunkach kwasowych, przy czym fosfolipaza kodowana przez matrycę kwasu nukleinowego nie jest aktywna w warunkach kwasowych. W -23- jednym aspekcie, zmieniona lub inna aktywność oznacza aktywność fosfolipazy w wysokiej temperaturze, przy czym fosfolipaza kodowana przez matrycę kwasu nukleinowego nie jest aktywna w wysokiej temperaturze. W jednym aspekcie, sposób jest iteracyjnie powtarzany do momentu wyprodukowania sekwencji kodującej fosfolipazę mającą zmienione wykorzystywanie kodonów od tego dla matrycy kwasu nukleinowego. Sposób może być iteracyjnie powtarzany do momentu wyprodukowania genu fosfolipazy mającego wyższy lub niższy poziom ekspresji informacji lub stabilności od tej dla matrycy kwasu nukleinowego. [0080] Ujawnienie zapewnia sposoby modyfikowania kodonów kwasu nukleinowego kodującego fosfolipazę do zwiększenia ekspresji w komórkach gospodarza, przy czym sposób obejmuje (a) zapewnianie kwasu nukleinowego według ujawnienia kodującego fosfolipazę; i, (b) identyfikowanie niepreferowanego lub mniej preferowanego kodonu w kwasie nukleinowym z etapu (a) i zastąpienie go preferowanym lub neutralnie stosowanym kodonem kodującym ten sam aminokwas jako zastąpiony kodon, przy czym preferowany kodon jest kodonem nadreprezentowanym w sekwencji kodującej w genach w komórce gospodarza i kodon niepreferowany lub mniej preferowany jest kodonem niedostatecznie reprezentowanym w sekwencji kodującej w genach w komórce gospodarza, w ten sposób modyfikując kwas nukleinowy w celu zwiększenia jego ekspresji w komórce gospodarza. [0081] Ujawnienie zapewnia sposoby modyfikowania kodonów w kwasie nukleinowym kodującym fosfolipazę, przy czym sposób obejmuje (a) zapewnianie kwasu nukleinowego według wynalazku kodującego fosfolipazę; oraz (b) identyfikowanie kodonu w kwasie nukleinowym z etapu (a) i zastępowanie go innym kodonem kodującym ten sam aminokwas, co zastępowany kodon, tym samym modyfikowanie kodonów w kwasie nukleinowym kodującym fosfolipazę. [0082] Ujawnienie zapewnia sposoby modyfikowania kodonów w kwasie nukleinowym kodującym fosfolipazę, w celu podwyższenia jego ekspresji w komórce gospodarza, przy czym sposób obejmuje (a) zapewnianie kwasu nukleinowego według ujawnienia kodującego fosfolipazę; oraz (b) identyfikowanie niekorzystnego lub mniej korzystnego kodonu w kwasie nukleinowym z etapu (a) i zastępowanie go korzystnym lub obojętnym w użytku kodonem kodującym ten sam aminokwas, co zastępowany kodon, przy czym korzystny kodon oznacza kodon nadreprezentowany w sekwencjach kodujących w genach w komórce gospodarza, a niekorzystny lub mniej korzystny kodon oznacza kodon niedostatecznie reprezentowany w sekwencjach kodujących w genach w komórce gospodarza, tym samym modyfikowanie kwasu nukleinowego w celu podwyższenia jego ekspresji w komórce gospodarza. [0083] Ujawnienie zapewnia sposoby modyfikowania kodonu w kwasie nukleinowym kodującym fosfolipazę, w celu obniżenia jego ekspresji w komórce gospodarza, przy czym sposób obejmuje (a) zapewnianie kwasu nukleinowego według ujawnienia kodującego fosfolipazę; oraz (b) identyfikowanie co najmniej jednego korzystnego kodonu w kwasie nukleinowym z etapu (a) i zastępowanie go niekorzystnym lub mniej korzystnym kodonem kodującym ten sam aminokwas co zastępowany kodon, przy czym korzystny kodon oznacza kodon nadreprezentowany w sekwencjach kodujących w genach w komórce gospodarza, a niekorzystny lub mniej korzystny kodon oznacza kodon niedostatecznie reprezentowany w -24- sekwencjach kodujących w genach w komórce gospodarza, tym samym modyfikowanie kwasu nukleinowego w celu obniżenia jego ekspresji w komórce gospodarza. W alternatywnych aspektach, komórka gospodarza oznacza komórkę bakteryjną, komórkę grzyba, komórkę owadzią, komórkę drożdżową, komórkę roślinną, komórkę glonów (alg), porost lub komórkę ssaczą. [0084] Ujawnienie zapewnia sposoby do wytwarzania biblioteki kwasów nukleinowych kodujących szereg modyfikowanych miejsc aktywnych fosfolipazy lub miejsc wiązania substratu, przy czym modyfikowane miejsca aktywne lub miejsca wiązania substratu pochodzą od pierwszego kwasu nukleinowego zawierającego sekwencję kodująca pierwsze miejsce aktywne lub pierwszy miejsce wiązania substratu, przy czym sposób obejmuje: (a) zapewnianie pierwszego kwasu nukleinowego kodującego pierwsze miejsce aktywne lub pierwsze miejsce wiązania substratu, przy czym pierwsza sekwencja kwasu nukleinowego zawiera kwas nukleinowy według ujawnienia; (b) zapewnianie zestawu mutagennych oligonukleotydów, które kodują naturalnie występujące warianty aminokwasów w szeregu docelowych kodonów w pierwszym kwasie nukleinowym; oraz (c) zastosowanie zestawu mutagennych oligonukleotydów w celu wygenerowania zestawu wariantów kwasów nukleinowych kodujących miejsce aktywne lub miejsce wiązania substratu, kodujących szereg wariacji aminokwasów dla każdego kodonu aminokwasu, który był mutagenizowany, tym samym wytwarzając bibliotekę kwasów nukleinowych kodujących szereg modyfikowanych miejsc aktywnych fosfolipazy lub miejsc wiązania substratu. W alternatywnych aspektach sposób obejmuje mutagenizowanie pierwszego kwasu nukleinowego z etapu (a) za pomocą sposobu obejmującego optymizowany system ukierunkowanej ewolucji, mutagenezę typu Gene Site Saturation Mutagenesis? (GSSM?) i ponowne składanie syntetyczne z udziałem ligacji (SLR). Sposób może dodatkowo obejmować mutagenizowanie pierwszego kwasu nukleinowego z etapu (a) lub wariantów, za pomocą sposobu obejmującego podatny na błędy PCR, tasowanie, kierowaną oligonukleotydami mutagenezę, PCR typu składanie, mutagenezę za pomocą PCR ?seksualnego?, mutagenezę in vivo, mutagenezę kasetową, rekursywną mutagenezę zespołową, wykładniczą mutagenezę zespołową, mutagenezę miejscowo specyficzną, ponowne składanie genów, mutagenezę typu Gene Site Saturation Mutagenesis? (GSSM?), ponowne składanie syntetyczne z udziałem ligacji (SLR) i ich kombinację. Sposób może dodatkowo obejmować mutagenizowanie pierwszego kwasu nukleinowego z etapu (a) lub wariantów za pomocą sposobu obejmującego rekombinację, rekursywną rekombinację sekwencji, modyfikowaną tiofosforanem mutagenezę DNA, mutagenezę zawierającej matrycę uracylową, mutagenezę dupleksu z lukami, mutagenezę naprawczą punktowych niedopasowań, mutagenezę szczepu gospodarza niezdolnego do napraw, mutagenezę chemiczną, mutagenezę radiogeniczną, mutagenezę delecyjną, mutagenezę restrykcyjnoselekcyjną, mutagenezę restrykcyjno-oczyszczającą, syntezę sztucznych genów, mutagenezę zespołową, tworzenie multimerów chimerycznego kwasu nukleinowego i ich kombinację. [0085] Ujawnienie zapewnia sposoby wytwarzania małej cząsteczki obejmujący etapy: (a) zapewniania wielu enzymów biosyntetycznych zdolnych do syntetyzowania lub modyfikowania małej cząsteczki, przy czym jeden z enzymów obejmuje enzym fosfolipazę -25- kodowany przez kwas nukleinowy według ujawnienia; (b) zapewniania substratu dla co najmniej jednego z enzymów z etapu (a); i, (c) reakcja substratu z etapu (b) z enzymami w warunkach które ułatwiają wielu reakcjom biokatalitycznym wytworzenie małej cząsteczki przez szereg reakcji biokatalitycznych. [0086] Ujawnienie zapewnia sposoby modyfikowania małej cząsteczki, obejmujące etapy: (a) zapewniania enzymu fosfolipazy kodowanej przez kwas nukleinowy według ujawnienia; (b) zapewniania małej cząsteczki; i, (c) reakcji enzymu z etapu (a) z małą cząsteczką z etapu (b) w warunkach, które ułatwiają reakcję enzymatyczną katalizowaną przez enzym fosfolipazy, w ten sposób modyfikując małą cząsteczkę poprzez reakcję enzymatyczną fosfolipazy. W jednym aspekcie, sposób obejmuje dostarczenie wielu substratów małych cząsteczek dla enzymu z etapu (a), wytwarzając w ten sposób bibliotekę zmodyfikowanych małych cząsteczek wytwarzanych za pomocą co najmniej jednej reakcji enzymatycznej katalizowanej przez enzym fosfolipazy. W jednym aspekcie, sposób obejmuje ponadto wiele dodatkowych enzymów w warunkach, które ułatwiają wiele reakcji biokatalitycznych przez enzymy, tworząc bibliotekę zmodyfikowanych małych cząsteczek wytwarzanych przez wiele reakcji enzymatycznych. W jednym aspekcie, sposób dodatkowo obejmuje etap testowania biblioteki w celu określenia, czy dana modyfikowana mała cząsteczka która wykazuje pożądaną aktywność, występuje w bibliotece. Etap testowania biblioteki może ponadto obejmować etapy, w których systematyczne eliminowanie wszystkich z wyjątkiem jednej reakcji biokatalitycznych wykorzystywanych do produkcji części wielu zmodyfikowanych małych cząsteczek w bibliotece, testując część zmodyfikowanej małej cząsteczki pod kątem obecności lub nieobecności określonej modyfikowanej małej cząsteczki o pożądanej aktywności, i identyfikowanie co najmniej jednej konkretnej reakcji biokatalitycznej która wytwarza określoną zmodyfikowaną małą cząsteczkę o pożądanej aktywności. [0087] Ujawnienie zapewnia sposoby określania funkcjonalnego fragmentu enzymu fosfolipazy obejmujący etapy: (a) zapewniania enzymu fosfolipazy zawierającej sekwencję aminokwasową według ujawnienia; i, (b) usunięcia wielu reszt aminokwasowych z sekwencji z etapu (a) i testowania pozostałej podsekwencji pod kątem aktywności fosfolipazy, tym samym określając funkcjonalny fragment enzymu fosfolipazy. W jednym aspekcie, aktywność fosfolipazy mierzy się przez zapewnienie substratu fosfolipazy i wykrywanie wzrostu ilości substratu lub zmniejszenia ilości produktu reakcji. W jednym aspekcie, zmniejszenie ilości substratu enzymu lub zwiększenie ilości produktu reakcji ze związkiem testowym w stosunku do ilości substratu lub produktu reakcji bez związku testowego identyfikuje związek testowy jako aktywator aktywności fosfolipazy. [0088] Ujawnienie zapewnia sposoby rozszczepiania wiązania estrowego glicerolofosforanu obejmujące następujące etapy: (a) zapewniania polipeptydu mającego aktywność fosfolipazy, przy czym polipeptyd zawiera sekwencję aminokwasową według ujawnienia, lub polipeptyd jest kodowany przez kwas nukleinowy według ujawnienia; (b) zapewniania kompozycji zawierającej wiązanie estrowe glicerolofosforanu; i, (c) kontaktowania polipeptydu z etapu (a) z kompozycją z etapu (b) w warunkach, w których polipeptyd rozszczepia wiązanie estrowe glicerolofosforanu. W jednym aspekcie, warunki obejmują pomiędzy około pH 5 do -26- około 8,5, lub, pomiędzy około pH 4,5 (lub bardziej kwasowe, tj. pH < 4,5) do około 9,0 (lub bardziej zasadowe (tj. pH > 9). W jednym aspekcie, warunki obejmują temperaturę pomiędzy około 40°C i około 70°C. W jednym aspekcie, kompozycja zawiera olej roślinny. W jednym aspekcie, kompozycja zawiera fosfolipidów nasion oleistych. W jednym aspekcie, reakcja rozszczepienia może generować dającą się ekstrahować w warunkach wodnych fosforylowaną zasadę i digliceryd. [0089] Ujawnienie zapewnia sposoby hydrolizowania, rozbijania lub rozrywania zawierającej fosfolipid kompozycji, obejmujące zapewnianie co najmniej jednego polipeptydu według ujawnienia mającego aktywność fosfolipazy lub polipeptydu mającego aktywność fosfolipazy kodowanego przez co najmniej jeden kwas nukleinowy według ujawnienia; zapewnianie kompozycji zawierającej fosfolipid; i kontaktowanie polipeptydu z kompozycją w warunkach w których fosfolipaza hydrolizuje, rozbija lub rozrywa zawierającą fosfolipid kompozycję. W jednym aspekcie, sposób obejmuje stosowanie mieszania z wysokim ścinaniem kompozycji, a następnie mieszanie bez ścinania lub mieszania z niskim ścinaniem, z co najmniej jednym polipeptydem według ujawnienia mającym aktywność fosfolipazy, aby umożliwić odpowiednie ?kontaktowanie? substratu fosfolipidu z fosfolipazą. Co najmniej jeden polipeptyd mający aktywność fosfolipazy może być również obecny w etapie mieszania z wysokim ścinaniem. Sposób można praktykować w dowolnej skali, np. w skali zawierającej około 1 gram (g) do około 500, 1000, 2000, 2500, 5000 g, lub więcej, lub dowolną ilość w tym zakresie. [0090] Wynalazek zapewnia sposoby odśluzowywania oleju obejmujące poniższe etapy: (a) zapewniania co najmniej jednego polipeptydu mającego aktywność fosfolipazy, przy czym polipeptyd zawiera sekwencję aminokwasową według wynalazku, lub polipeptyd jest kodowany przez kwas nukleinowy według wynalazku; (b) zapewniania kompozycji zawierającej olej roślinny; oraz (c) kontaktowania polipeptydu z etapu (a) i oleju roślinnego z etapu (b) w warunkach, w którym polipeptyd może przecinać wiązania estrowe w oleju roślinnym, tym samym odśluzowywanie oleju. W jednym aspekcie olej roślinny zawiera nasiona oleiste. Olej roślinny może zawierać oleje z otrębów ryżowych, olej palmowy, olej rzepakowy, olej kukurydziany, olej sojowy, olej z rzepaku canola, olej sezamowy, olej arachidowy lub olej słonecznikowy. W jednym aspekcie sposób obejmuje dodatkowo dodawanie fosfolipazy według wynalazku do innej fosfolipazy lub ich kombinacji. W jednym aspekcie dodawany do sposobu jest więcej niż jeden polipeptyd mający aktywność fosfolipazy, przy czym co najmniej jeden polipeptyd oznacza enzym według wynalazku. W jednym aspekcie, enzymy dodaje się w określonej kolejności, np. PLC o odmiennych specyficznościach dodaje się w określonej kolejności, na przykład, enzym o aktywności PC i PE jest dodawany pierwszy (lub dwa enzymy dodaje się razem, jeden o aktywności PC i kolejny o aktywności PE), następnie dodawany jest enzym o aktywności PI PLC, lub dowolne ich kombinacje. [0091] W jednym aspekcie sposobu odśluzowywania oleju kompozycja zawierająca olej zawiera olej lub tłuszcz roślinny, zwierzęcy, z glonów lub ryb. Olej roślinny może zawierać olej z otrębów ryżowych, olej sojowy, olej rzepakowy, olej kukurydziany, olej z ziaren -27- palmowych, olej z rzepaku canola, olej słonecznikowy, olej sezamowy lub olej arachidowy. Polipeptyd może hydrolizować fosfatyd z ulegającego uwodnieniu i/lub nieulegającego uwodnieniu fosfolipidu w kompozycji zawierającej olej. W jednym aspekcie polipeptyd hydrolizuje fosfatyd z wiązania glicerylofosfoestrowego, w celu wygenerowania diglicerydu i rozpuszczalnego w wodzie związku fosforanu. W jednym aspekcie polipeptyd ma aktywność fosfolipazy C. W jednym aspekcie, polipeptyd oznacza fosfolipazę D i dodawany jest również enzym fosfatazy. [0092] W jednym aspekcie sposobu odśluzowywania oleju kontaktowanie obejmuje hydrolizę uwodnionego fosfolipidu w oleju. Warunki hydrolizy mogą obejmować warunki alkaliczne, np. w jednym aspekcie warunki obejmują temperaturę około 20°C do 40°C w zasadowym pH. Warunki alkaliczne mogą obejmować pH od około pH 8 do pH 10, lub więcej. Warunki hydrolizy mogą być alkalizowane w dowolnym momencie w sposobu, np. w jednym aspekcie, fosfolipaza taka, jak PLC, jest dodawana przed alkalizacją warunków (np. ?kaustyczne zobojętnienie? oleju zawierającego kwas taki, jak kwas fosfatydowy). [0093] W jednym aspekcie sposobu odśluzowywania oleju zasada powoduje izomeryzację 1,2-DAG, wyprodukowanego przez PLC, do 1,3-DAG, który zapewnia odżywcze korzyści zdrowotne względem 1,2-DAG, np. 1,3-DAG jest spalany jako energia, a nie odkładany jako tłuszcz (jak 1,2-DAG). Zatem ujawnienie zapewnia sposób kaustycznego rafinowania oleju, w którym fosfolipaza, np. enzym według wynalazku, w tym PLC, jest dodawana ?na początku?, tj. przed dodaniem jakiegokolwiek kwasu i sody kaustycznej, np. jak zilustrowano w przykładowym sposobie z Figury 13. Jedną z konsekwencji dodawania PLC na początku sposobu rafinacji, za pomocą sody kaustycznej według ujawnienia (patrz dalsze omówienie, poniżej), i dodawania kwasu i substancji żrącej później, jest generowanie podwyższonego poziomu 1,3-DAG (nie 1,2-DAG). Może to być konsekwencją przeniesienia acylu, katalizowanego kwasem lub zasadą. Żywieniowo, 1,3-DAG jest lepszy niż 1,2-DAG. Zatem wynalazek obejmuje sposób odśluzowywania oleju przy użyciu PLC według wynalazku, dzięki któremu końcowy produkt oleju po odśluzowywaniu zawiera nie mniej niż około 0,5%, 1,0%, 2,0%, 3,0%, 4,0% lub 5,0% 1,3-DAG. [0094] W jednym aspekcie sposobu odśluzowywania oleju warunki hydrolizy mogą obejmować czas reakcji od około 3 do 10 lub więcej minut. Warunki hydrolizy mogą obejmować hydrolizę ulegających uwodnieniu i nieulegających uwodnieniu fosfolipidów w oleju w temperaturze od około 50°C do 60°C, w pH od około pH 5 do pH 6,5, lub od około pH 5 do pH 7,5, lub od około pH 5 do pH 8,0, z zastosowaniem czasu reakcji od około 30 do 60 minut. [0095] W jednym aspekcie sposobu odśluzowywania oleju polipeptyd jest związany z filtrem, a zawierający fosfolipid tłuszcz lub olej jest przepuszczany przez filtr. Polipeptyd można dodawać do roztworu zawierającego tłuszcz lub olej zawierające fosfolipidy, a następnie roztwór jest przepuszczany przez filtr. [0096] W jednym aspekcie odśluzowywania oleju sposób obejmuje dodatkowo fizyczne usunięcie substancji śluzowatej wyprodukowanej w sposobie odśluzowywania, przez -28- dodawanie substancji do utwardzania, np. talku lub odpowiednika. W jednym aspekcie, zwiększa to wydajność otrzymywania oleju. [0097] Wynalazek zapewnia również sposoby przekształcania nieulegającego uwodnieniu fosfolipidu do postaci ulegającej uwodnieniu, obejmujące poniższe etapy: (a) zapewnianie polipeptydu mającego aktywność fosfolipazy, przy czym polipeptyd zawiera sekwencję aminokwasową według wynalazku, lub polipeptyd jest kodowany przez kwas nukleinowy według wynalazku; (b) zapewnianie kompozycji zawierającej nieulegający uwodnieniu fosfolipid; oraz (c) kontaktowania polipeptydu z etapu (a) i nieulegającego uwodnieniu fosfolipidu z etapu (b) w warunkach, w którym polipeptyd może przecinać wiązania estrowe w nieulegającym uwodnieniu fosfolipidzie, tym samym przekształcanie nieulegającego uwodnieniu fosfolipidu do postaci ulegającej uwodnieniu. [0098] Wynalazek zapewnia sposoby odśluzowywania oleju obejmujące poniższe etapy: (a) zapewniania kompozycji zawierającej polipeptyd według wynalazku mający aktywność fosfolipazy lub polipeptyd kodowany przez kwas nukleinowy według wynalazku; (b) zapewniania kompozycji zawierającej tłuszcz lub olej zawierający fosfolipid; i (c) kontaktowania polipeptydu z etapu (a) i kompozycji z etapu (b) w warunkach, w którym polipeptyd może odśluzować zawierającą fosfolipid kompozycję (w warunkach, w którym polipeptyd według wynalazku może katalizować hydrolizę fosfolipidu). W jednym aspekcie, kompozycja zawierająca olej zawiera olej roślinny, zwierzęcy, z glonów lub ryb. Olej roślinny może zawierać olej z otrębów ryżowych, olej sojowy, olej rzepakowy, olej kukurydziany, olej z ziaren palmowych, olej z rzepaku canola, olej słonecznikowy, olej sezamowy lub olej arachidowy. Polipeptyd może hydrolizować fosfatyd z ulegającego uwodnieniu i/lub nieulegającego uwodnieniu fosfolipidu w kompozycji zawierającej olej. Polipeptyd może hydrolizować fosfatyd z wiązania glicerylofosfoestrowego, w celu wygenerowania diglicerydu i rozpuszczalnego w wodzie związku fosforanu. Polipeptyd może mieć aktywność fosfolipazy C, B, A lub D. W jednym aspekcie, aktywność fosfolipazy D i enzymu fosfatazy dodaje się. Kontaktowanie może obejmować hydrolizę uwodnionego fosfolipidu w oleju. Warunki hydrolizy mogą obejmować temperaturę od około 20°C do 40°C w zasadowym pH. Warunki alkaliczne mogą obejmować pH od około pH 8 do pH 10. Warunki hydrolizy mogą obejmować czas reakcji od około 3 do 10 minut. Warunki hydrolizy mogą obejmować hydrolizę ulegających uwodnieniu i nieulegających uwodnieniu fosfolipidów w oleju w temperaturze od około 50°C do 60°C, w pH od około pH 5 do pH 6,5 z zastosowaniem czasu reakcji od około 30 do 60 minut. Polipeptyd może być związany z filtrem, a tłuszcz lub olej zawierający fosfolipid jest przepuszczany przez filtr. Polipeptyd można dodawać do roztworu zawierającego tłuszcz lub olej zawierające fosfolipidy, a następnie roztwór jest przepuszczany przez filtr. [0099] Wynalazek zapewnia sposoby przekształcania nieulegającego uwodnieniu fosfolipidu do postaci ulegającej uwodnieniu, obejmujące poniższe etapy: (a) zapewniania kompozycji zawierającej polipeptyd według wynalazku mający aktywność fosfolipazy lub polipeptyd kodowany przez kwas nukleinowy według wynalazku; (b) zapewniania kompozycji zawierającej nieulegający uwodnieniu fosfolipid; i (c) kontaktowania polipeptydu z etapu (a) i -29- kompozycji z etapu (b) w warunkach, w którym polipeptyd może odśluzować zawierającą fosfolipid kompozycję (w warunkach, w którym polipeptyd przekształca nieulegający uwodnieniu fosfolipid do postaci ulegającej uwodnieniu. Polipeptyd może mieć aktywność fosfolipazy C. Polipeptyd może mieć aktywność fosfolipazy D i dodawany jest również enzym fosfatazy. [0100] Ujawnienie zapewnia sposoby kaustycznego rafinowania zawierającej fosfolipid kompozycji, obejmujące poniższe etapy: (a) zapewniania kompozycji zawierającej fosfolipazę, która może oznaczać polipeptyd według wynalazku mający aktywność fosfolipazy lub polipeptyd kodowany przez kwas nukleinowy według ujawnienia; (b) zapewniania kompozycji zawierającej fosfolipid; i (c) kontaktowania polipeptydu z etapu (a) z kompozycją z etapu (b) przed, podczas lub po kaustycznym rafinowaniu. Polipeptyd może mieć aktywność fosfolipazy, np. aktywność PLC, PLB, PLD i/lub PLA. Polipeptyd można dodawać przed kaustycznym rafinowaniem, tj. ?na początku? sposobu, przed dodaniem kwasu lub sody kaustycznej, jak zilustrowano na Figurze 13. [0101] Polipeptyd (który może być PLC według wynalazku) może dodać podczas rafinowania kaustycznego i można dodać różne poziomy kwasu i sody kaustycznej w zależności od poziomów fosforu i poziomy wolnych kwasów tłuszczowych. Polipeptyd (który może być enzymem według wynalazku) można dodawać przed rafinowaniem kaustycznym, lub, po rafinowaniu kaustycznym: w intensywnym mieszalniku lub mieszalniku retencyjnym przed rozdziałem; po etapie ogrzewania; w wirówce; w sopstoku; w wodzie do przemywania; i/lub w trakcie etapów bielenia i odwaniania. Sposób może obejmować zastosowanie stężonych roztworów sody kaustycznej, np. bardziej stężonych niż standard przemysłowy 11%, aby zmniejszyć masę śluzu. W alternatywnych aspektach, Stężony roztwór sody kaustycznej ma stężenie pomiędzy około 12% i 50%, np. stężenie około 20%, 30%, 40%, 50% lub 60%, lub więcej. [0102] Kompozycja zawierająca fosfolipid może zawierać roślinę. Polipeptyd może być eksprymowany transgenicznie w roślinie. Polipeptyd mający aktywność fosfolipazy można dodawać podczas miażdżenia nasion lub innej części rośliny, lub, polipeptyd mający aktywność fosfolipazy jest dodawany po zmiażdżeniu lub przed rafinowaniem. [0103] Zapewnia się również sposób rafinacji kaustycznej, do hydrolizowania fosfolipidów w oleju (np. olej roślinny) przy użyciu polipeptydu według wynalazku, w celu wygenerowania diacyloglicerolu (DAG) i rozpuszczalnego w wodzie estru fosforanowego. W jednym aspekcie, enzym według ujawnienia musi funkcjonować w sposobie rafinacji kaustycznej, w tym, opcjonalnie z małą ilością wody i/lub w zakresie temperatur około 55°C do około 70°C. Stosowanie sposobu rafinacji kaustycznej z małą ilością wody w tym zakresie temperatur zmaksymalizuje wydajność przez podwyższenie ilości DAG i zmniejszenie ilości porywanych kropelek oleju. W jednym aspekcie, enzym stosowany w tym sposobie rafinacji według ujawnienia za pomocą sody kaustycznej ma zarówno bardzo dobrą aktywność wobec fosfatydylocholiny (PC), jak i fosfatydyloetanoloaminy (PE), jest aktywny w pH rzędu od około pH 6 do pH 9, jest aktywny aż do 75°C, i jest aktywny w małej ilości wody w oleju, np. -30- około 2% do 5% wody, np. enzym kodowany przez sekwencję z SEQ ID NO:2, kodowaną np. przez SEQ ID NO:1. [0104] W innym aspekcie sposobu rafinacji kaustycznej według ujawnienia do hydrolizowania fosfolipidów w olejach, stosuje się dwa enzymy: PLC specyficzną dla PI (hydrolizuje PI), i PC-PLC, która hydrolizuje PC, PE i PA. Ten przykład wykonania generuje olej odpowiedni do chemicznego lub fizycznego rafinowania i maksymalizuje wzrost wydajności z DAG, i daje mniejszą ilość zawieszonego oleju. [0105] Wynalazek zapewnia sposoby oczyszczania fitosterolu lub triterpenu obejmujące następujące etapy: (a) zapewniania kompozycji zawierającej polipeptyd według wynalazku mający aktywność fosfolipazy, lub polipeptyd kodowany przez kwas nukleinowy według wynalazku; (b) zapewniania kompozycji zawierającej fitosterol lub triterpen; i (c) kontaktowania polipeptydu z etapu (a) z kompozycją z etapu (b) w warunkach, w których polipeptyd może katalizować hydrolizę fosfolipidu w kompozycji. Polipeptyd może mieć aktywność fosfolipazy C. Fitosterol lub triterpen może obejmować sterol roślinny. Sterol roślinny może pochodzić z oleju roślinnego. Olej roślinny może zawierać olej z otrębów ryżowych, olej kokosowy, olej z rzepaku canola, olej z masła kakaowego, olej kukurydziany, olej z nasion bawełny, olej lniany, olej z oliwek, olej palmowy, olej arachidowy, olej pochodzący z otrąb ryżowych, olej szafranowy, olej sezamowy, olej sojowy lub olej słonecznikowy. Sposób może obejmować stosowanie rozpuszczalników niepolarnych do ilościowej ekstrakcji wolnych fitosteroli i estrów kwasów tłuszczowych fitosterylu. Fitosterol lub triterpen może obejmować ?-sitosterol, kampesterol, stigmasterol, stigmastanol, ?sitostanol, sitostanol, desmosterol, chalinasterol, poriferasterol, clionasterol lub brasykasterol. [0106] Ujawnienie zapewnia sposoby rafinowania surowego oleju, obejmujące poniższe etapy: (a) zapewniania kompozycji zawierającej polipeptyd według ujawnienia mający aktywność fosfolipazy lub polipeptyd kodowany przez kwas nukleinowy według ujawnienia; (b) zapewniania kompozycji zawierającej olej zawierający fosfolipid; i (c) kontaktowania polipeptydu z etapu (a) z kompozycją z etapu (b) w warunkach, w którym polipeptyd może katalizować hydrolizę fosfolipidu w kompozycji. Polipeptyd może mieć aktywność fosfolipazy C. Polipeptyd może mieć aktywność fosfolipazy w roztworze wodnym, który jest dodawany do kompozycji. Poziom wody może wynosić od około 0,5 do 5%. Czas trwania sposobu może wynosić mniej niż około 2 godziny, mniej niż około 60 minut, mniej niż około 30 minut, mniej niż 15 minut, lub mniej niż 5 minut. Warunki hydrolizy mogą obejmować temperaturę od około 25°C do 70°C. Warunki hydrolizy mogą obejmować stosowanie substancji żrących. Można stosować stężone roztwory sody kaustycznej, np. bardziej stężone niż przemysłowy standard 11%, do zmniejszenia masy substancji śluzowych. W alternatywnych aspektach, stężony roztwór sody kaustycznej ma stężenie od około 12% do 50%, np. stężenie około 20%, 30%, 40%, 50%, lub 60% lub wyższe. [0107] Warunki hydrolizy mogą obejmować pH od około pH 3 do pH 10, od około pH 4 do pH 9, lub od około pH 5 do pH 8. Warunki hydrolizy mogą obejmować dodawanie emulgatorów i/lub mieszanie po kontaktowaniu z etapu (c). Sposoby mogą obejmować dodawanie demulgatora i/lub ogrzewanie lub chłodzenie (np. od około 4°C do około -20°C, -31- lub poniżej) aby stymulować rozdział fazy wodnej. Sposoby mogą obejmować odśluzowywanie przed etapem kontaktowania, dla zebrania lecytyny przez wirowanie i następnie dodawanie PLC, PLC i/lub PLA, w celu usunięcia nieulegających uwodnieniu fosfolipidów. Sposoby mogą obejmować wodne odśluzowywanie surowego oleju do mniej niż 10 ppm fosforu dla olejów jadalnych, i późniejsze fizyczne rafinowanie do mniej niż około 50 ppm fosforu dla olejów typu biodiesel. Sposoby mogą obejmować dodawanie kwasu w celu stymulowania uwodnienia nieulegających uwodnieniu fosfolipidów. W jednym aspekcie, dodawanie kwasu stymuluje obniżenie zawartości metalu wapnia i magnezu. [0108] Ujawnienie zapewnia sposób łagodzenia lub zapobiegania toksyczności zależnej od lipopolisaccharydu (LPS) obejmujący podawanie pacjentowi kompozycji farmaceutycznej zawierającej polipeptyd według ujawnienia. Ujawnienie zapewnia sposób detoksykacji endotoksyny obejmujący kontaktowanie enterotoksyny z polipeptydem według wynalazku. Wynalazek zapewnia sposób deacylowania łańcucha kwasu tłuszczowego 2' lub 3' z lipidu A obejmujący kontaktowanie lipidu A z polipeptydem według wynalazku. [0109] Ujawnienie zapewnia sposób rafinacji smaru obejmujący następujące etapy: (a) zapewniania kompozycji zawierającej enzym według ujawnienia; (b) zapewniania smaru; i (c) traktowania smaru enzymem w warunkach, w których enzym może selektywne hydrolizować oleje w smarze, w ten sposób rafinując go. Smar może być olejem hydraulicznym. [0110] Ujawnienie zapewnia sposób obróbki tkanin obejmujący następujące etapy: (a) zapewniania kompozycji zawierającej enzym według ujawnienia, (b) zapewniania tkaniny; i (c) traktowania tkaniny enzymem. Traktowanie tkaniny może obejmować poprawę ściśliwości i sprężystości ostatecznej tkaniny, barwienia, uzyskanie ognioodporności, uzyskanie wodoodporności, uzyskanie jasności optycznej lub uzyskanie wykończenia żywicy. Tkanina może zawierać bawełnę, wiskozę, sztuczny jedwab, lyocell, len, len, ramię, wszelkie ich mieszanki, lub ich mieszanki z poliestrami, wełną, poliamidami akrylowymi lub poliakrylami. Ujawnienie zapewnia tkaninę, przędzę lub włókno zawierające enzym według ujawnienia. Enzym można adsorbować, absorbować lub unieruchamiać na powierzchni tkaniny, przędzy lub włókna. [0111] Wynalazek zapewnia sposoby eksprymowania fosfolipazy C, obejmujące zapewnianie szczepu Pichia o fenotypie Mut+; wprowadzanie kwasu nukleinowego kodującego heterologiczną fosfolipazę C do szczepu Pichia; oraz, hodowanie szczepu Pichia w warunkach, dzięki którym eksprymowana jest fosfolipaza C. Sposób może dodatkowo obejmować uzupełnianie warunków hodowli o cynk. Wynalazek zapewnia również układy komórkowe, izolowane komórki i linie komórkowe do eksprymowania fosfolipazy C zawierającej fenotyp Mut+ w szczepie Pichia, zawierające kwas nukleinowy kodujący heterologiczną fosfolipazę C funkcjonalnie połączoną do promotora działającego w szczepie Pichia. [0112] Wynalazek zapewnia oporne na zeocynę układy komórek drożdży (np. komórki drożdży, linie komórkowe, poszczególne komórki) do eksprymowania heterologicznego białka, obejmujące etapy zapewniania komórki Pichia sp. (np. P. pastoris) zawierającej -32- heterologiczny kwas nukleinowy zdolny do eksprymowania heterologicznego białka; hodowanie komórki w warunkach zawierających zeocynę w wyjściowym stężeniu; selekcjonowanie komórek opornych na wyjściowe stężenie zeocyny, i ponowne hodowanie w warunkach zawierających wyższe stężenie zeocyny; i selekcjonowanie komórek hodowanych w etapie (c) opornych na wyższe stężenie zeocyny. W jednym aspekcie, heterologiczne białko oznacza enzym, lub opcjonalnie, fosfolipazę, lub opcjonalnie fosfolipazę C (PLC), np. dowolny enzym według wynalazku. [0113] Szczegóły jednego lub więcej przykładu wykonania wynalazku są podane na towarzyszących rysunkach i w opisie poniżej. Inne cechy, cele i zalety wynalazku będą oczywiste z poniższego opisu, rysunków i z zastrzeżeń patentowych. [0114] Wszystkie publikacje, patenty, zgłoszenia patentowe, sekwencje z GenBank i depozyty ATCC przytoczone w opisie są tu wyraźnie włączone przez odniesienie dla wszystkich celów. KRÓTKI OPIS RYSUNKÓW [0115] Następujące rysunki ilustrują przykłady wykonania według wynalazku i nie mają na celu ograniczenia zakresu według wynalazku objętego zastrzeżeniami. Figura 1 do schemat blokowy systemu komputerowego, jak opisano szczegółowo poniżej. Figura 2 to schemat przepływowy ilustrujący jeden aspekt procesu 200 do porównywania nowej sekwencji nukleotydu lub białka z bazą danych sekwencji, w celu określenia poziomu homologii pomiędzy nową sekwencją i sekwencjami w bazie danych, jak opisano szczegółowo poniżej. Figura 3 to schemat przepływowy ilustrujący jeden przykład wykonania procesu w komputerze, w celu określenia czy dwie sekwencje są homologiczne, jak opisano szczegółowo poniżej. Figura 4 to schemat przepływowy ilustrujący jeden aspekt procesu identyfikatora do wykrywania obecności cechy w sekwencji, jak opisano szczegółowo poniżej. Figury 5A, 5B i 5C schematycznie ilustrują model dwufazowego systemu do symulacji regulowanego za pomocą PLC odśluzowywania, jak opisano szczegółowo w Przykładzie 2, poniżej. Figura 6 schematycznie ilustruje przykładowy sposób rafinowania oleju roślinnego przy użyciu fosfolipaz według wynalazku. Figura 7 schematycznie ilustruje przykładowy sposób odśluzowywania według wynalazku dla olejów rafinowanych fizycznie, jak omówiono szczegółowo poniżej. Figura 8 schematycznie ilustruje hydrolizę fosfatydu przez fosfolipazę C według wynalazku, jak omówiono szczegółowo poniżej. -33- Figura 9 schematycznie ilustruje przykładowy sposób rafinacji kaustycznej według ujawnienia, i ilustruje alternatywny przykład wykonania obejmujący stosowanie fosfolipazy C według wynalazku jako ?Pomoc w kaustycznym rafinowaniu? (ang. ?Caustic Refining Aid?) (ang. Long Mix Caustic Refining), jak omówiono szczegółowo poniżej. Figura 10 schematycznie ilustruje nanoszenie fosfolipazy C według wynalazku, jako pomocy w odśluzowywaniu, jak omówiono szczegółowo poniżej. Figura 11 do wykres opisujący wybrane cechy przykładowych kwasów nukleinowych i polipeptydów według wynalazku, jak opisano bardziej szczegółowo poniżej. Figura 12 schematycznie ilustruje dane z systemu dwóch enzymów według wynalazku, jak opisano w Przykładzie 3, poniżej. Figura 13 schematycznie ilustruje przykładowy sposób rafinacji kaustycznej według ujawnienia, i ilustruje alternatywny przykład wykonania obejmujący nanoszenie fosfolipazy C według wynalazku jako ?Pomoc w kaustycznym rafinowaniu? (ang. ?Caustic Refining Aid?) (ang. Long Mix Caustic Refining), jak omówiono szczegółowo poniżej. Figura 14 ilustruje inny wariant sposobów według ujawnienia, w którym w sposobie stosuje się dwa etapy wirowania, jak omówiono szczegółowo poniżej. Figura 15 ilustruje inny wariant sposobów według ujawnienia, w którym w sposobie stosuje się trzy etapy wirowania, jak omówiono szczegółowo poniżej. Figura 16 ilustruje kolejny przykładowy wariant tego sposobu, przy użyciu traktowania kwasem i z etapem wirowania przed etapem odśluzowywania, jak omówiono szczegółowo poniżej. Figura 17 ilustruje wyniki doświadczeń trawienia in vitro, w których warianty fosfolipazy C według wynalazku, jak omówiono szczegółowo w Przykładzie 4, poniżej. Figura 18 ilustruje wyniki hodowli okresowej w fermentorze, przy użyciu przykładowego enzymu według wynalazku, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 19 ilustruje wyniki porównań szybkości wychwytywania tlenu (?OUR?; ang. Oxygen Uptake Rate) dla hodowli szczepów P. pastoris MutS według wynalazku, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 20 ilustruje porównanie profilu zużycia metanolu w szczepach P. pastoris MutS według wynalazku, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 21 ilustruje profil ?OUR? hodowli rekombinowanej postaci przykładowego enzymu PLC według wynalazku SEQ ID NO:2, jak omówiono szczegółowo w Przykładzie 5, poniżej. -34- Figura 22 ilustruje wyniki z SDS-PAGE wskazujące na jakość białka PLC wyprodukowanego w hodowli, i odpowiadający profil OUR hodowli rekombinowanej postaci przykładowego enzymu PLC według wynalazku SEQ ID NO:2, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 23 ilustruje wyniki z SDS-PAGE wskazujące na ilość aktywnej PLC zlokalizowanej wewnątrzkomórkowo w hodowli rekombinowanej postaci przykładowego enzymu PLC według ujawnienia SEQ ID NO:2, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 24 ilustruje wizualizację zmian morfologicznych w komórkach drożdży powiązanych z aktywną PLC ? rekombinowaną postacią przykładowego enzymu PLC według wynalazku SEQ ID NO:2, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 25 obrazowo podsumowuje dane wskazujące na status wydajności produkcji PLC po 95 godz. TFT (całkowity czas fermentacji) w Pichia, przy użyciu przykładowego enzymu PLC według ujawnienia SEQ ID NO:2, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 26 jest tabelarycznym zestawieniem danych z badań przesiewowych ekspresji przykładowych przystosowanych do zeocyny kolonii komórek według wynalazku, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 27 ilustruje dane pokazujące, że poziomy białka PLC były wyższe w hodowlach zawierających przykładowe przystosowane do zeocyny kolonie komórek według wynalazku, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 28 ilustruje dane wskazujące na porównanie wzrostu przystosowanych do zeo kolonii według wynalazku vs kontrola, jak omówiono szczegółowo w Przykładzie 5, poniżej. Figura 29 ilustruje wyniki doświadczenia ogrzewania, wykazujące termostabilność przykładowego enzymu według ujawnienia z SEQ ID NO:2, z warunkami wskazanymi na figurze, jak omówiono szczegółowo w Przykładzie 6, poniżej. Figura 30 ilustruje dane NMR podsumowujące doświadczenie ogrzewania, wykazujące termostabilność przykładowego enzymu według wynalazku z SEQ ID NO:2, jak omówiono szczegółowo w Przykładzie 6, poniżej. Figury 31, 32 i 33 ilustrują dane wykazujące na termostabilność SEQ ID NO:2 przy użyciu p-NPPC, w warunkach pokazanych na figurze, jak omówiono szczegółowo w Przykładzie 6, poniżej. Figura 34 ilustruje dane wykazujące termostabilność SEQ ID NO:2 przy użyciu analizy DSC, jak omówiono szczegółowo w Przykładzie 6, poniżej. [0116] Podobne symbole referencyjne na różnych rysunkach wskazują na podobne elementy. SZCZEGÓŁOWY OPIS -35- [0117] Niniejsze ujawnienie zapewnia fosfolipazy, np. polipeptydy mające aktywność fosfolipaz A, B, C, D, patatyn, fosfataz kwasu fosfatydowego (PAP) i/lub hydrolazy acylolipidów (LAH) lub równoważną, kodujące je polinukleotydy i sposoby ich wytwarzania i stosowania. Wynalazek zapewnia enzymy, które skutecznie rozszczepiają glicerolofosforanowe wiązanie estrowe w olejach takich, jak oleje roślinne, np. fosfolipidy nasion oleistych, w celu wygenerowania ekstrahowalnych za pomocą wody fosforylowanej zasady i diglicerydu. W jednym aspekcie, fosfolipazy według ujawnienia mają aktywność hydrolazy acylolipidów (LAH). W alternatywnych aspektach, fosfolipazy według wynalazku mogą przecinać glicerolofosforanowe wiązania estrowe w fosfatydylocholinie (PC), fosfatydyloetanoloaminie (PE), fosfatydyloserynie (PS), fosfatydyloinozytolu (PI), kwasie fosfatydowym i/lub sfingomielinie, lub ich kombinacjach. Na przykład, w jednym aspekcie, fosfolipaza według wynalazku jest specyficzna dla jednego lub więcej specyficznych substratów, np. enzym według wynalazku może mieć specyfikę działania dla PE i PC; PE i PI; PE i PS; PS i PE; PS i PI; PI i PE; PS, PI i PC; PE, PI i PC; lub, PE, PS, PI i PC. [0118] Fosfolipazę według wynalazku (np. polipeptydy mające aktywność fosfolipazy A, B, C, D, patatyny, fosfataz kwasu fosfatydowego (PAP) i/lub hydrolazy acylolipidów (LAH) lub równorzędną) można stosować do enzymatycznego odśluzowywania olejów roślinnych, ponieważ ugrupowanie fosforanu jest rozpuszczalne w wodzie i łatwe do usunięcia. Produkt diglicerydu pozostanie w oleju i w konsekwencji zmniejszy straty. PLC według wynalazku można stosować oprócz lub zamiast PLA1 i PLA2 w komercyjnym odśluzowywaniu oleju, takim jak proces ENZYMAX?, w którym fosfolipidy są hydrolizowane przez PLA1 i PLA2. [0119] Fosfolipazy według wynalazku mogą być aktywne w wysokiej i/lub w niskiej temperaturze, lub w szerokim zakresie temperatur, np. mogą one być aktywne w temperaturach w zakresie od 20°C do 90°C, od 30°C do 80°C, lub od 40°C do 70°C. Wynalazek zapewnia również fosfolipazy według wynalazku, które wykazują aktywność w zasadowym pH lub w kwasowym pH, np. kwasowość z małą ilością wody. W alternatywnych aspektach, fosfolipazy według wynalazku mogą wykazywać aktywność w kwasowych pH, zaledwie pH 6,5, pH 6,0, pH 5,5, pH 5,0, pH 4,5, pH 4,0 i pH 3,5 lub bardziej kwasowych (tj. < pH 3,5). W alternatywnych aspektach, fosfolipazy według wynalazku mogą wykazywać aktywność w zasadowych pH, aż pH 7,5, pH 8,0, pH 8,5, pH 9,0, pH 9,5, pH 10 lub bardziej zasadowych (tj. > pH 10). W jednym aspekcie, fosfolipazy według wynalazku są aktywne w zakresie temperatur od około 40°C do około 70°C, 75°C, lub 80°C, lub więcej, w warunkach aktywności z małą ilością wody (niska zawartość wody). [0120] Ujawnienie zapewnia również sposoby dalszego modyfikowania przykładowych fosfolipaz według ujawnienia, w celu wygenerowania enzymów o pożądanych właściwościach. Na przykład, fosfolipazy generowane sposobami według ujawnienia mogą mieć zmienione specyficzności wobec substratu, specyficzności wiązania substratu, wzorce przecinania substratu, termostabilność, profil pH/aktywności, profil pH/stabilności (taki jak podwyższona stabilność w niskich wartościach pH, np. pH<6 lub pH<5, lub wysokich, np. pH>9), stabilność w warunkach utleniania, zależność od Ca2+, aktywność specyficzną i podobne. Ujawnienie zapewnia zmienianie dowolnej przedmiotowej właściwości. Na -36- przykład, zmiana może doprowadzić do powstania wariantu, który, w porównaniu do macierzystej fosfolipazy, ma zmieniony profil pH i aktywności temperaturowej. [0121] W jednym aspekcie, fosfolipazy według wynalazku są stosowane na różnych etapach obróbki oleju roślinnego takich, jak w ekstrakcji oleju roślinnego, szczególnie, w usuwaniu ?fosfolipidowych substancji śluzowych? w sposobie nazywanym ?odśluzowywaniem oleju?, jak tu opisanym. Wynalazek zapewnia kompozycje (np. zawierające enzymy według wynalazku) i sposoby do produkcji olejów roślinnych z różnych źródeł takich, jak olej z otrębów ryżowych, nasion soi, nasion rzepaku, orzechów ziemnych, sezamu, słonecznika i kukurydzy. Enzymy fosfolipazy według wynalazku można stosować zamiast PLA, np. fosfolipazy A2, na dowolnym etapie obróbki oleju roślinnego. Definicje [0122] Określenie ?fosfolipaza? obejmuje enzymy mające jakąkolwiek aktywność fosfolipazy, na przykład, przecinanie glicerolofosforanowego wiązania estrowego (katalizowanie hydrolizy glicerolofosforanowego wiązania estrowego), np. w oleju, takim jak olej roślinny. Aktywność fosfolipazy według wynalazku może generować dającą się ekstrahować wodą fosforylowaną zasadę i digliceryd. Aktywność fosfolipazy według wynalazku obejmuje również hydrolizę glicerolofosforanowego wiązania estrowego w wysokich temperaturach, niskich temperaturach, zasadowym pH i w kwasowym pH. Określenie ?aktywność fosfolipazy? obejmuje również przecinanie estru glicerolofosforanowego w celu wygenerowania ekstrahowalnej wodą fosforylowanej zasady i diglicerydu. Określenie ?aktywność fosfolipazy? obejmuje również cięcie wiązania estrowego gliceryny i kwasu fosforowego w fosfolipidach. Określenie ?aktywność fosfolipazy? obejmuje również inne aktywności takie, jak zdolność do wiązania się z i hydrolizowania substratu takiego, jak olej, np. olej roślinny, substrat obejmuje również roślinne i zwierzęce fosfatydylocholiny, fosfatydyloetanoloaminy, fosfatydyloseryny i sfingomieliny. Aktywność fosfolipazy może obejmować aktywność fosfolipazy C (PLC); aktywność fosfolipazy A (PLA) taką, jak aktywność fosfolipazy A1 lub fosfolipazy A2; aktywność fosfolipazy B (PLB) taką, jak aktywność fosfolipazy B1 lub fosfolipazy B2, w tym aktywność lizofosfolipazy (LPL) i/lub aktywność lizofosfolipazy-transacylazy (LPTA); aktywność fosfolipazy D (PLD) taką, jak aktywność fosfolipazy D1 lub fosfolipazy D2; i/lub aktywność patatyny, lub dowolne ich kombinacje. Aktywność fosfolipazy może obejmować hydrolizę glikoproteiny, np. jak glikoproteiny znajdywanej w bulwie ziemniaka lub dowolnej roślinie z rodzaju Solanum, np. Solanum tuberosum. Aktywność fosfolipazy może obejmować aktywność enzymatyczna patatyny taką, jak aktywność esterazy patatyny (patrz, np. Jimenez (2002) Biotechnol. Prog. 18:635-640). Aktywność fosfolipazy może obejmować aktywność hydrolazy acylolipidowej (LAH). Aktywność fosfolipazy może obejmować bycie specyficzną dla jednego lub więcej specyficznych substratów, np. enzym według wynalazku może mieć specyfikę działania dla PE i PC; PE i PI; PE i PS; PS i PE; PS i PI; PI i PE; PS, PI i PC; PE, PI i PC; lub, PE, PS, PI i PC lub dowolne ich kombinacje. [0123] W jednym aspekcie, fosfolipaza według wynalazku może mieć wielofunkcyjną aktywność, np. kombinację jednej lub więcej opisanych tu aktywności enzymatycznych. Na -37- przykład, w jednym aspekcie, polipeptyd według ujawnienia jest enzymatycznie aktywny, ale pozbawiony aktywności lipazy, np. pozbawiony jakiejkolwiek aktywności enzymatycznej, która oddziałuje na obojętną frakcję oleju (trójgliceryd). Pożądane może być stosowanie takiego polipeptydu w określonym sposobie, np. w sposobie odśluzowywania, w którym ważne jest, aby obojętna frakcja oleju nie doznała uszczerbku (nie została umniejszona, np. zhydrolizowana). Zatem w jednym aspekcie, wynalazek zapewnia na przykład sposób odśluzowywania obejmujący stosowanie polipeptydu według wynalazku, mającego aktywność fosfolipazy, ale nie aktywność lipazy. [0124] W jednym aspekcie, fosfolipazy PLC według wynalazku wykorzystują (np. katalizują hydrolizę) szereg substratów fosfolipidowych, w tym fosfatydylocholinę (PC), fosfatydyloetanoloaminę (PE), fosfatydyloserynę (PS), fosfatydyloinozytol (PI) i/lub kwas fosfatydowy lub ich kombinację. Dodatkowo, te enzymy mogą mieć różne stopnie aktywności wobec postaci lizofosfolipidowych tych fosfolipidów. W różnych aspektach, enzymy PLC według wynalazku mogą wykazywać preferencję dla fosfatydylocholiny i fosfatydyloetanoloaminy jako substratów. [0125] W jednym aspekcie, fosfolipazy PLC fosfatydyloinozytolu według wynalazku wykorzystują szereg substratów fosfolipidowych, w tym fosfatydylocholinę, fosfatydyloetanoloaminę, fosfatydyloserynę, fosfatydyloinozytol, i kwas fosfatydowy, lub ich kombinację. Dodatkowo, te enzymy mogą mieć różne stopnie aktywności wobec postaci lizofosfolipidowych tych fosfolipidów. W różnych aspektach, enzymy PLC fosfatydyloinozytolu według wynalazku mogą wykazywać preferencję dla fosfatydyloinozytolu jako substratu. [0126] W jednym aspekcie, enzymy patatyny według ujawnienia według wynalazku wykorzystują szereg substratów fosfolipidowych, w tym fosfatydylocholinę, fosfatydyloetanoloaminę, fosfatydyloserynę, fosfatydyloinozytol, i kwas fosfatydowy, lub ich kombinację. Dodatkowo, te enzymy mogą mieć różne stopnie aktywności wobec postaci lizofosfolipidowych tych fosfolipidów. W różnych aspektach, patatyny według ujawnienia oparte są na zachowaniu podobieństwa sekwencji aminokwasowej. W różnych aspektach, enzymy te wykazują zróżnicowany zestaw właściwości biochemicznych i mogą przeprowadzić reakcje charakterystyczne dla klas enzymów PLA1, PLA2, PLC lub PLD. [0127] W jednym aspekcie, PLD fosfolipazy według ujawnienia wykorzystują szerego substratów fosfolipidowych, w tym fosfatydylocholinę, fosfatydyloetanoloaminę, fosfatydyloserynę, fosfatydyloinozytol, i kwas fosfatydowy, lub ich kombinację. Dodatkowo, te enzymy mogą mieć różne stopnie aktywności wobec postaci lizofosfolipidowych tych fosfolipidów. W jednym aspekcie, enzymy te są użyteczne do prowadzenia reakcji transestryfikacji do wytworzenia fosfolipidów ustrukturyzowanych. [0128] Określenie ?przeciwciało? obejmuje peptyd lub polipeptyd pochodzący od, wzorowany na lub zasadniczo kodowany przez gen immunoglobuliny lub geny kodujące immunoglobuliny, lub ich fragmenty, zdolne do specyficznego wiązania antygenu bądź epitopu, patrz, np. Fundamental Immunology, Third Edition, W.E. Paul, ed., Raven Press, -38- N.Y. (1993); Wilson (1994) J. Immunol. Methods 175:267-273; Yarmush (1992) J. Biochem. Biophys. Methods 25:85-97. Określenie przeciwciało obejmuje fragmenty wiążące antygen, czyli ?miejsce wiążące antygen? (na przykład fragmenty, podsekwencje, regiony determinujące komplementarność (CDR)), które zachowują zdolność do wiązania antygenu, w tym: (i) fragment Fab, monowalentny fragment składający się z domen VL, VH, CL i CH1; (ii) fragment F(ab')2, biwalentny fragment składający się z dwóch fragmentów Fab połączonych mostkiem dwusiarczkowym w regionie zawiasowym; (iii) fragment Fd składający się z domen VH i CH1; (iv) fragment Fv składający się z domen VL i VH pojedynczego ramienia przeciwciała, (v) fragment dAb (Ward i wsp., (1989) Nature 341:544546), która składa się z domeny VH; i (vi) wyizolowany region determinujący komplementarność (CDR). Przeciwciała jednołańcuchowe są również zawarte w odniesieniu do terminu ?przeciwciało?. [0129] Określenia ?macierz? lub ?mikromacierz? lub ?biochip? albo ?chip? w użytym tu znaczeniu oznaczają wiele elementów docelowych, przy czym ten każdy element docelowy zawiera określoną ilość jednego lub większej liczby polipeptydów (włącznie z przeciwciałami) lub kwasów nukleinowych unieruchomionych na określonym obszarze powierzchni podłoża, co omówiono bardziej szczegółowo poniżej. [0130] W stosowanym tu kontekście, określenia ?komputer?, ?program komputerowy? i ?procesor? są używane w ich najszerszym kontekście ogólnym i wprowadzają wszystkie takie urządzenia, jak opisane szczegółowo poniżej. [0131] ?Sekwencja kodująca? lub ?sekwencja koduje? dany polipeptyd lub białko jest sekwencją kwasu nukleinowego, która podlega transkrypcji i translacji do polipeptydu lub białka, po umieszczeniu pod kontrolą odpowiednich sekwencji regulatorowych.. [0132] Opisane tu określenie ?kaseta ekspresyjna? dotyczy sekwencji nukleotydowej, która jest zdolna do oddziaływania na ekspresję genu strukturalnego (tj. sekwencja kodująca białko takie, jak fosfolipaza według wynalazku) w gospodarzu kompatybilnym z takimi sekwencjami. Kasety ekspresyjne obejmują co najmniej promotor funkcjonalnie połączony z sekwencją kodującą polipeptyd; i, ewentualnie z innymi sekwencjami, np. sygnałami terminacji transkrypcji. Dodatkowe czynniki niezbędne lub pomagające w wywołaniu ekspresji także można stosować, na przykład, wzmacniacze. ?Funkcjonalnie połączony? w stosowanym tu znaczeniu odnosi się do wiązania promotora w górę od sekwencji DNA tak, że promotor pośredniczy w transkrypcji sekwencji DNA. Zatem, kasety ekspresyjne obejmują także plazmidy, wektory ekspresyjne, rekombinowane wirusy, każdą postać zrekombinowanego wektora ?nagiego DNA? i podobne. ?Wektor? zawiera kwas nukleinowy, który może zakażać, transfekować, przejściowo lub trwale transdukować komórkę. Zrozumiałe będzie, że wektor może być nagim kwasem nukleinowym lub kwasem nukleinowym skompleksowanym z białkiem lub lipidem. Wektor zawiera ewentualnie wirusowe lub bakteryjne kwasy nukleinowe i/lub białka, i/lub błony (np. błona komórkowa, wirusowa otoczka lipdowa, itd.). Wektory obejmują, ale nie są ograniczone do replikonów (np. replikony RNA, bakteriofagi) do których fragmenty DNA można dołączyć i replikować. W ten sposób wektory obejmują, ale nie ograniczają się do RNA, autonomicznego -39- replikującego się kołowego lub liniowego DNA lub RNA (np. plazmidy, wirusy i podobne, patrz, np. Patent US Nr 5,217,879), i obejmują zarówno plazmidy ekspresyjne i nie ekspresyjne. Gdzie rekombinowany mikroorganizm lub hodowla komórkowa jest opisana jako stanowiąca gospodarza dla ?wektora ekspresyjnego? dotyczy to zarówno pozachromosomowego kolistego i liniowego DNA i DNA, który został wprowadzony do chromosomu(ów) gospodarza. Gdzie wektor jest utrzymywany przez komórkę gospodarza, wektor może być albo stabilnie replikowany w komórkach w czasie mitozy jako autonomiczna struktury, albo jest wprowadzany do genomu gospodarza. [0133] ?Plazmidy? są oznaczane małą literą ?p? poprzedzającą i/lub po której następują duże litery i/lub cyfry. Plazmidy rozpoczynające są albo dostępne w handlu, powszechnie dostępne w sposób nieograniczony, albo mogą być wykonane z dostępnych plazmidów zgodne z opublikowanymi procedurami. Ponadto, plazmidy równoważne do tych opisanych w niniejszym opisie, są znane w dziedzinie i będzie oczywiste dla znawcy w dziedzinie. [0134] Określenie ?gen? oznacza odcinek DNA zaangażowany w wytwarzanie łańcucha polipeptydowego, w tym, m.in., regiony poprzedzające i położone za regionem kodującym takie, jak lider i trailer, promotory i wzmacniacze, jak również, w stosownych przypadkach, sekwencje interweniujące (introny) pomiędzy poszczególnymi odcinkami kodującymi (eksony). [0135] Stosowane tu frazy ?kwas nukleinowy? lub ?sekwencja kwasu nukleinowego? dotyczą oligonukleotydu, nukleotydu, polinukleotydu, lub fragmentu dowolnego z nich, DNA lub RNA (np. mRNA, rRNA, tRNA, iRNA) pochodzenia genomowego lub syntetycznego, który może być jednoniciowy lub dwuniciowy i może stanowić nici sensowne lub antysensowne, peptydu kwasu nukleinowego (PNA), lub dowolnego materiału podobnego do DNA lub podobnego do RNA, naturalnego lub syntetycznego pochodzenia, w tym, na przykład, iRNA, rybonukleoproteidy (np. dwuniciowe iRNA, np. iRNP). Określenie to obejmuje również struktury podobne do kwasów nukleinowych z syntetycznymi szkieletami, zobacz na przykład Mata (1997) Toxicol. Appl. Pharmacol. 144:189-197; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Samstag (1996) Antisense Nucleic Acid Drug Dev 6:153-156. [0136] Stosowany tu ?aminokwas? lub ?sekwencja aminokwasowa? odnosi się do peptydu, oligopeptydu, polipeptydu, lub sekwencji białka lub fragmentu, części lub podjednostki każdego z nich, oraz naturalnie występujących lub syntetycznych cząsteczek. [0137] Stosowane tu określenia ?polipeptyd? i ?białko? dotyczą aminokwasów połączonych ze sobą przez wiązania peptydowe, lub modyfikowane wiązania peptydowe, tj. izostery peptydów, i mogą zawierać modyfikowane aminokwasy inne niż 20 aminokwasów kodowanych przez geny. Określenie ?polipeptyd? obejmuje również peptydy i fragmenty polipeptydów, motywy i podobne. Określenie obejmuje również glikozylowane polipeptydy. Peptydy i polipeptydy według ujawnienia obejmują również wszystkie formy ?mimetyczne? i ?peptydomimetyczne?, jak opisano bardziej szczegółowo poniżej [0138] Określenie ?wyizolowany? oznacza, że materiał jest usunięty ze swojego oryginalnego środowiska (np. środowiska naturalnego, jeżeli występuje naturalnie). Na przykład, naturalnie -40- występujący polipeptyd lub polinukleotyd obecny w żywym zwierzęciu nie jest wyizolowany, ale ten sam polinukleotyd lub polipeptyd, oddzielony od niektórych lub wszystkich współistniejących materiałów w naturalnym układzie, jest wyizolowany. Takie polinukleotydy mogą być częścią wektora i/lub takie polinukleotydy lub polipeptydy mogą być częścią kompozycji i nadal być wyizolowane w taki sposób, że wektor lub kompozycja nie jest częścią jego naturalnego środowiska. W stosowanym tu kontekście, wyizolowany materiał lub kompozycja może być również ?oczyszczoną? kompozycja, tj. nie wymaga to bezwzględnej czystości; raczej ma mieć względną definicję. Poszczególne kwasy nukleinowe uzyskane z biblioteki mogą być konwencjonalnie oczyszczane do elektroforetycznej homogeniczności. W alternatywnych aspektach, ujawnienie zapewnia kwasy nukleinowe, które zostały oczyszczone z genomowego DNA albo z innych sekwencji w bibliotece lub innym środowisku, o co najmniej jedną, dwie, trzy, cztery, pięć lub więcej rzędów wielkości. [0139] Stosowane tu określenie ?rekombinowany? oznacza, że kwas nukleinowy sąsiaduje ze ?szkieletem? kwasu nukleinowego, z którym nie sąsiaduje w swoim naturalnym środowisku. W jednym aspekcie, kwasy nukleinowe stanowią 5% lub więcej liczby insertów kwasu nukleinowego w populacji ?cząsteczek szkieletowych? kwasu nukleinowego. ?Cząsteczki szkieletowe? zgodnie z ujawnieniem obejmują kwasy nukleinowe takie, jak wektory ekspresyjne, samoreplikujące kwasy nukleinowe, wirusy, integrujące się kwasy nukleinowe, i inne wektory lub kwasy nukleinowe stosowane do utrzymywania lub operacji przedmiotowym insertem kwasu nukleinowego. W jednym aspekcie, wzbogacone kwasy nukleinowe stanowią 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% lub więcej liczby insertów kwasu nukleinowego w populacji rekombinowanych cząsteczek szkieletowych. ?Rekombinowane? polipeptydy lub białka dotyczą polipeptydów lub białek wyprodukowanych za pomocą technik rekombinowanego DNA; np. wyprodukowanych z komórek transformowanych egzogennym konstruktem DNA, kodującym pożądany polipeptyd lub białko. ?Syntetyczne? polipeptydy lub białko oznaczają te otrzymane na drodze syntezy chemicznej, jak opisano bardziej szczegółowo poniżej. [0140] Sekwencja promotora jest ?funkcjonalnie połączona? z sekwencją kodującą, gdy polimeraza RNA, która inicjuje transkrypcję z promotora, będzie transkrybowała sekwencję kodującą do mRNA, jak omówiono poniżej. [0141] ?Oligonukleotyd? odnosi się do zarówno jednoniciowego polideoksynukleotydu lub dwóch komplementarnych nici polideoksynukleotydowych, które mogą być syntetyzowane chemicznie. Takie syntetyczne oligonukleotydy nie mają fosforanu 5', a zatem nie będą ulegały ligacji z innym oligonukleotydem bez dodatku fosforanu za pomocą ATP w obecności kinazy. Syntetyczny oligonukleotyd będzie ulegał ligacji do fragmentu, który nie został defosforylowany. [0142] Fraza ?zasadniczo identyczny? w kontekście dwóch kwasów nukleinowych lub polipeptydów, dotyczy dwóch lub więcej sekwencji, które mają co najmniej 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 98% lub 99% identyczności nukleotydów lub reszta aminokwasowych (sekwencji), przy porównywaniu i dopasowaniu z maksimum zgodności, jak zmierzono przy użyciu dowolnego znanego algorytmu do porównywania sekwencji, jak -41- omówiono szczegółowo poniżej, lub przez sprawdzanie wizualne. Alternatywnie, ujawnienie zapewnia kwas nukleinowy i sekwencje polipeptydów mające znaczną identyczność wobec przykładowych sekwencji według ujawnienia, np. SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, itd., na regionie co najmniej około 100 reszt, 150 reszt, 200 reszt, 300 reszt, 400 reszt, lub regionu w zakresie od około 50 reszt do pełnej długości kwasu nukleinowego lub polipeptydu. Sekwencje kwasu nukleinowego według wynalazku mogą być zasadniczo identyczne na całej długości regionu kodującego polipeptyd. [0143] Dodatkowo ?zasadniczo identyczna? sekwencja aminokwasowa oznacza sekwencję, która różni się od sekwencji referencyjnej o jedną lub więcej konserwatywnych lub niekonserwatywnych substytucji, delecji lub insercji aminokwasów, szczególnie gdy taka substytucja występuje w miejscu, które nie jest miejscem aktywnym cząsteczki, i pod warunkiem, że polipeptyd zasadniczo zachowuje swoje właściwości funkcjonalne. Konserwatywna substytucja aminokwasu, na przykład, zastępuje aminokwas innym z tej samej klasy (np. substytucja jednego hydrofobowego aminokwasu takiego, jak izoleucyna, walina, leucyna lub metionina na inny, lub substytucja jednego polarnego aminokwasu na inny taka, jak substytucja argininy na lizynę, kwasu glutaminowego na kwas asparaginowy lub glutaminy na asparaginę). Jeden lub więcej aminokwasów mogą ulec delecji, na przykład, z polipeptydu fosfolipazy, co skutkuje modyfikacją struktury polipeptydu, bez istotnego zmieniania jego aktywności biologicznej. Na przykład, można usuwać aminokwasy na końcu aminowym lub karboksylowym, które nie są wymagane do aktywności biologicznej fosfolipazy. Modyfikowane sekwencje polipeptydów według wynalazku mogą być oznaczane pod kątem aktywności biologicznej fosfolipazy na szereg sposobów, w tym kontaktowanie modyfikowanej sekwencji polipeptydu z substratem fosfolipazy i określanie, czy modyfikowany polipeptyd obniża ilość specyficznego substratu w oznaczeniu lub zwiększa ilość bioproduktów reakcji enzymatycznej funkcjonalnej fosfolipazy z substratem, jak omówiono dokładniej poniżej. [0144] ?Hybrydyzacja? odnosi się do procesu, w którym nić kwasu nukleinowego łączy się z komplementarną nicią poprzez parowanie zasad. Reakcje hybrydyzacji mogą być czułe i selektywne tak, że można zidentyfikować konkretną sekwencję będącą przedmiotem zainteresowania nawet w przypadku próbek, w których występuje ona przy niskich stężeniach. Odpowiednio rygorystyczne warunki mogą być określone przez, na przykład, stężenie soli lub formamidu w roztworach do prehybrydyzacji i hybrydyzacji lub temperaturę hybrydyzacji i są dobrze znane w tej dziedzinie techniki. Na przykład, rygorystyczność można zwiększyć przez zmniejszenie stężenia soli, zwiększenie stężenia formamidu lub podniesienie temperatury hybrydyzacji, zmieniając czas hybrydyzacji, jak opisano szczegółowo poniżej. W alternatywnych aspektach, kwasy nukleinowe według ujawnienia są zdefiniowane przez ich zdolność do hybrydyzacji w rozmaitych warunkach rygorystyczności (np. wysoka, średnia i niska), jak określono w niniejszym dokumencie. [0145] Określenie ?wariant? dotyczy polinukleotydów lub polipeptydów według wynalazku modyfikowanych przy jednej lub więcej par zasad, kodonach, intronach, eksonach lub -42- resztach aminokwasowych (odpowiednio), które jednak nadal zachowują aktywność biologiczną fosfolipazy według wynalazku. Warianty mogą być produkowane za pomocą dowolnych środków, w tym sposobów takich, jak, na przykład, PCR podatna na błędy, tasowanie, mutagenezę ukierunkowaną oligonukleotydami, PCR typu składanie, seksualną mutagenezę PCR, mutagenezę in vivo, mutagenezę kasetową, rekursywną mutagenezę zespołową, wykładniczą mutagenezę zespołową, specyficzną miejscowo mutagenezę, ponowne składanie genów, GSSM? i ich dowolną kombinację. Techniki do wytwarzania wariantów fosfolipazy mających aktywność w pH lub temperaturze, na przykład, która jest różna od fosfolipazy typu dzikiego są ujęte w opisie. [0146] Określenie ?mutageneza nasyceniowa?, Gene Site Saturation Mutagenesis? (GSSM?) lub ?GSSM?? [mutageneza nasyceniowa miejsc genowych] obejmuje sposób, który wykorzystuje zdegenerowane startery oligonukleotydowe do wprowadzania mutacji punktowych do polinukleotydu, jak opisano szczegółowo poniżej. [0147] Określenie ?optymizowany system ukierunkowanej ewolucji? lub ?optymizowana ukierunkowana ewolucja? obejmuje sposób ponownego składania fragmentów powiązanych sekwencji kwasu nukleinowego, np. powiązanych genów, i jest szczegółowo wyjaśniony poniżej. [0148] Określenie ?ponowne składanie syntetyczne z udziałem ligacji? lub ?SLR? obejmuje sposób ligowania oligonukleotydowych fragmentów w niestochastyczny sposób, i jest szczegółowo wyjaśniony poniżej. Generowanie i Manipulowanie Kwasami Nukleinowymi [0149] Ujawnienie zapewnia wyizolowane i rekombinowane kwasy nukleinowe (np. przykładowe SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, SEQ ID NO:71, SEQ ID NO:73, SEQ ID NO:75, SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:91, SEQ ID NO:93, SEQ ID NO:95, SEQ ID NO:97, SEQ ID NO:99, SEQ ID NO:101, SEQ ID NO:103, SEQ ID NO:105, SEQ ID NO:107, SEQ ID NO:109, SEQ ID NO:111, SEQ ID NO:113, SEQ ID NO:115, SEQ ID NO:117, SEQ ID NO:119, SEQ ID NO:121, SEQ ID NO:123, SEQ ID NO:125, SEQ ID NO:127, SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ ID NO:135, SEQ ID NO:137, SEQ ID NO:139, SEQ ID NO:141, SEQ ID NO:143, SEQ ID NO:145, SEQ ID NO:147, SEQ ID NO:149, SEQ ID NO:151, SEQ ID NO:153, SEQ ID NO:155, SEQ ID NO:157, SEQ ID NO:159, SEQ ID NO:161, SEQ ID NO:163, SEQ ID NO:165, SEQ ID NO:167, SEQ ID NO:169, SEQ ID NO:171 lub SEQ ID NO:173), w tym kasety ekspresyjne takie, jak wektory ekspresyjne, kodujące polipeptydy i fosfolipazy według ujawnienia. Ujawnienie obejmuje -43- również sposoby odkrywania nowych sekwencji fosfolipazy przy użyciu kwasów nukleinowych według wynalazku. Zapewnia się również sposoby modyfikowania kwasów nukleinowych według ujawnienia, np. przez ponowne składanie syntetyczne z udziałem ligacji, optymizowany system ukierunkowanej ewolucji i/lub mutagenezę nasyceniową. [0150] Kwasy nukleinowe według wynalazku mogą być wytwarzane, izolowane i/lub manipulowane np. przez klonowanie i ekspresję bibliotek cDNA, amplifikację informacyjnego lub genomowego DNA za pomocą PCR, i podobne. W praktykowaniu sposobów według wynalazku homologiczne geny mogą być modyfikowane przez manipulowanie opisaną tu matrycą kwasu nukleinowego. Wynalazek można praktykować w połączeniu z dowolnym sposobem lub protokołem lub urządzeniem, znanym ze stanu techniki, które są dobrze opisane w literaturze naukowej i patentowej. Techniki Ogólne [0151] Kwasy nukleinowe stosowane do praktykowania wynalazku, czy RNA, iRNA, antysensowny kwas nukleinowy, cDNA, genomowy DNA, wektory, wirusy lub ich hybrydy, można izolować z szeregu źródeł, modyfikować sposobami inżynierii genetycznej, amplifikować i/lub eksprymować/ generować na drodze rekombinacji. Rekombinowane polipeptydy generowane z tych kwasów nukleinowych mogą być indywidualnie izolowane lub klonowane i testowane pod kątem pożądanej aktywności. Można stosować dowolny układ ekspresyjny na drodze rekombinacji, w tym układy ekspresyjne oparte na komórkach bakteryjnych, ssaczych, komórkach drożdży, komórkach owadzich lub roślinnych. [0152] Alternatywnie, te kwasy nukleinowe mogą być syntetyzowane in vitro za pomocą dobrze znanych technik syntezy chemicznej, jak opisano np. w Adams (1983) J. Am. Chem. Soc. 105:661; Belousov (1997) Nucleic Acids Res. 25:3440-3444; Frenkel (1995) Free Radic. Biol. Med. 19:373-380; Blommers (1994) Biochemistry 33:7886-7896; Narang (1979) Meth. Enzymol. 68:90; Brown (1979) Meth. Enzymol. 68:109; Beaucage (1981) Tetra. Lett. 22:1859; Patent US Nr 4,458,066. [0153] Techniki manipulowania kwasami nukleinowymi takie, jak, na przykład, subklonowanie, sondy do znakowania (np. znakowanie losowym starterem z użyciem polimerazy Klenowa, miejsce translacji nick, amplifikacja), sekwencjonowanie, hybrydyzację i podobne są dobrze opisane w literaturze naukowej i patentowej, patrz, np., Sambrook, ed., MOLECULAR CLONING: A LABORATORY MANUAL (2ND ED.), Vols. 1-3, Cold Spring Harbor Laboratory, (1989); CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, Ausubel, ed. John Wiley & Sons, Inc., New York (1997); LABORATORY TECHNIQUES IN BIOCHEMISTRY AND MOLECULAR BIOLOGY: HYBRIDIZATION WITH NUCLEIC ACID PROBES, Part I. Theory and Nucleic Acid Preparation, Tijssen, ed. Elsevier, N.Y. (1993). [0154] Kolejnym użytecznym środkiem do otrzymywania i manipulowania kwasami nukleinowymi, stosowanym do praktykowania sposobów według ujawnienia jest klonowanie z próbek genomowych, oraz, o ile jest to pożądane, wykonywanie badań przesiewowych i przeklonowywanie insertów izolowanych lub amplifikowanych z, np. klonów genomowych -44- lub klonów cDNA. Źródła kwasów nukleinowych stosowane w sposobach według wynalazku obejmują biblioteki genomowe lub cDNA zawarte w, np. ssaczych sztucznych chromosomach (MAC), patrz np. Patenty US Nry 5,721,118; US 6,025,155; ludzkich sztucznych chromosomach, patrz np. Rosenfeld (1997) Nat. Genet. 15:333-335; sztucznych chromosomach drożdży (YAC); bakteryjnych sztucznych chromosomach (BAC); sztucznych chromosomach P1, patrz np. Woon (1998) Genomics 50:306-316; wektorach będących pochodnymi P1 (PACs), patrz np. Kern (1997) Biotechniques 23:120-124; kosmidach, rekombinowanych wirusach, fagach lub plazmidach. [0155] W jednym aspekcie, kwas nukleinowy kodujący polipeptyd według wynalazku jest łączony w odpowiedniej fazie z sekwencją liderową zdolna do ukierunkowywania sekrecji ulegającego translacji polipeptydu lub jego fragmentu. [0156] Ujawnienie zapewnia białka fuzyjne i kodujące je kwasy nukleinowe. Polipeptyd według ujawnienia może być połączony z heterologicznym peptydem lub polipeptydem takim, jak N-końcowe peptydy identyfikacyjne, które nadają pożądane cechy takie, jak zwiększenie stabilności lub uproszczone oczyszczanie. Peptydy i polipeptydy według ujawnienia można także syntetyzować i eksprymować jako białka fuzyjne z jednym lub większą liczbą dodatkowych domen z nimi związanych, np. dla wytwarzania bardziej immunogennego peptydu, aby łatwiej wyizolować peptyd syntezowany metodami rekombinacji, w celu identyfikacji i izolacji przeciwciała i komórek B z ekspresją przeciwciała, i podobne. Wykrywanie i ułatwienie oczyszczania domen obejmuje np. peptydy chelatujące metale takie, jak ścieżki polihistydynowe oraz moduły histydynowotryptofanowe, które pozwalają na oczyszczanie na unieruchomionych metalach, domeny białka A, które umożliwiają oczyszczanie na unieruchomionej immunoglobulinie, i domeny wykorzystywane w układach oczyszczania powinowactwem/przedłużenie FLAGS (Immunex Corp, Seattle WA). Włączenie rozszczepialnych sekwencji łącznika jak Factor Xa lub enterokinazy (Invitrogen, San Diego CA) między domeną oczyszczania i peptydem lub polipeptydem zawierającym motyw aby ułatwić oczyszczenie. Na przykład, wektor ekspresyjny może zawierać sekwencję kwasu nukleinowego kodującą epitop połączoną z sześcioma resztami histydyny, a następnie miejscem cięcia dla tioredoksyny i enterokinazy (patrz, np. Williams (1995) Biochemistry 34:1787-1797; Dobeli (1998) Protein Expr. Purif. 12:404-414). Reszty histydyny ułatwiają wykrywanie i oczyszczanie a miejsce cięcia enterokinazy zapewnia środki do oczyszczania epitopu od reszty białka fuzyjnego. Technologia dotycząca wektorów kodujących białka fuzyjne i zastosowanie białek fuzyjnych są dobrze opisane w literaturze naukowej i patentowej, patrz, np. Kroll (1993) DNA Cell. Biol., 12:441-53. Transkrypcyjne i translacyjne sekwencje kontrolne, [0157] Ujawnienie zapewnia sekwencje kwasu nukleinowego (np. DNA) według ujawnienia powiązane funkcjonalnie z sekwencjami kontrolnymi ekspresji (np. transkrypcyjnymi lub translacyjnymi) np. promotorami lub wzmacniaczami, do kierowania lub modulowania syntezy/ekspresji RNA. Sekwencje do kontrolowania ekspresji mogą występować w wektorze ekspresyjnym. Przykładowe bakteryjne promotory obejmują lacI, lacZ, T3, T7, gpt, lambda -45- PR, PL i trp. Przykładowe eukariotyczne promotory obejmują natychmiastowy wczesny CMV, kinazę tymidynową HSV, wczesny i późny SV40, LTRy z retrowirusa, i mysią metalotioneinę I. [0158] Promotory odpowiednie do eksprymowania polipeptydu w bakteriach obejmują promotory E. coli lac lub trp, promotor lacI, promotor lacZ, promotor T3, promotor T7, promotor gpt, promotor lambda PR, promotor lambda PL, promotory z operonów kodujących enzymy glikolityczne takie, jak kinaza 3-fosfoglicerynianu (PGK), i promotor kwaśnej fosfatazy. Eukariotyczne promotory natychmiastowy wczesny promotor CMV, promotor kinazy tymidynowej HSV, promotory szoku cieplnego, wczesny i późny promotor SV40, LTRy z retrowirusów, i mysi promotor metalotioneiny-I. Można również stosować inne promotory znane z kontrolowania ekspresji genów w komórkach prokariotycznych lub eukariotycznych, lub ich wirusów. Wektory ekspresyjne i nośnik do klonowania [0159] Wynalazek zapewnia wektory ekspresyjne i nośnik do klonowania zawierający kwasy nukleinowe według wynalazku, np. sekwencje kodujące fosfolipazy według wynalazku. Wektory ekspresyjne i nośnik do klonowania według wynalazku mogą zawierać cząstki wirusowe, bakulowirusa, faga, plazmidy, fagemidy, kosmidy, fosmidy, bakteryjne sztuczne chromosomy, wirusowy DNA (np. ospy bydlęcej, adenowirusa, wirus ospy ptasiej, wścieklizny rzekomej i pochodne SV40), oparte na P1 sztuczne chromosomy, plazmidy drożdży, sztuczne chromosomy drożdży, i wszelkie inne wektory specyficzne dla przedmiotowych specyficznych gospodarzy (takich jak Bacillus, Aspergillus i drożdże). Wektory według wynalazku mogą obejmować chromosomalne, niechromosomalne i syntetyczne sekwencje DNA. Duże ilości odpowiednich wektorów są znane znawcom, i są dostępne w handlu. Przykładowe wektory obejmują: bakteryjne: wektory pQE (Qiagen), plazmidy pBluescript, wektory pNH, (wektory lambda-ZAP (Stratagene); ptrc99a, pKK223-3, pDR540, pRIT2T (Pharmacia); eukariotyczne: pXT1, pSG5 (Stratagene), pSVK3, pBPV, pMSG, pSVLSV40 (Pharmacia). Niemniej jednak, każdy inny plazmid lub inny wektor może być stosowany, o ile są jest on zdolny do replikacji i utrzymywania się w gospodarzu. Niskie liczby kopii lub wysokie liczby kopii wirusów mogą być stosowane w niniejszym wynalazku. [0160] Wektor ekspresyjny może zawierać promotor, miejsce wiązania rybosomu dla inicjacji translacji i terminator transkrypcji. Wektor może również zawierać odpowiednie sekwencje dla amplifikacji ekspresji. Ssacze wektory ekspresyjne mogą zawierać miejsce rozpoczęcia replikacji, wszelkie niezbędne miejsca wiązania rybosomu, miejsce poliadenylacji, donorowe i akceptorowe miejsca składania, transkrypcyjne sekwencje terminacji, i nieulegające transkrypcji sekwencje flankujące 5?. W niektórych aspektach, sekwencje DNA pochodzące z miejsca składania i poliadenylacji SV40 można wykorzystać w celu zapewnienia wymaganych nietranskrybowanych elementów genetycznych. [0161] W jednym aspekcie, wektory ekspresyjne zawierają jeden lub więcej genów markerów podlegających selekcji dla umożliwienia selekcji komórek gospodarza zawierających ten wektor. Takie markery podlegające selekcji obejmują geny kodujące reduktazę dihydrofolanu -46- lub geny nadające odporność na neomycynę dla hodowli komórek eukariotycznych, geny nadające oporność na ampicylinę lub tetracyklinę w E. coli, i gen TRP 1 S. cerevisiae. Regiony promotorowe mogą być wybrane z dowolnego żądanego genu z użyciem wektorów transferazy chloramfenikolu (CAT) lub innych wektorów z markerów selekcyjnych. [0162] Wektory ekspresyjne polipeptydu lub jego fragmentu w komórkach eukariotycznych mogą zawierać wzmacniacze w celu zwiększenia poziomu ekspresji. Wzmacniacze to elementy cis działające w układzie DNA, zwykle od około 10 do około 300 bp długości, które działają na promotor w celu zwiększenia jego transkrypcji. Przykłady obejmują wzmacniacz SV40 po późnej stronie miejsca początku replikacji bp 100 do 270, wzmacniacz wczesnego promotora cytomegalowirusa, wzmacniacz polioma z późnej strony miejsca inicjacji replikacji oraz wzmacniacze adenowirusowe [0163] Sekwencję DNA można wstawić do wektora za pomocą szeregu procedur. Na ogół, sekwencję DNA poddaje się ligacji do żądanej pozycji w wektorze po trawieniu wstawki i wektora odpowiednimi enzymami restrykcyjnymi. Alternatywnie, można poddać ligacji tępe końce zarówno wstawki, jak i wektora. Różne techniki klonowania, są znane w dziedzinie, na przykład, jak opisane w Ausubel i Sambrook. Takie procedury i inne są uważane za znajdujące się w zakresie umiejętności znawcy w tej dziedzinie. [0164] Wektor może być w postaci plazmidu, cząstki wirusowej lub faga. Inne wektory obejmują chromosomalne, niechromosomalne i syntetyczne sekwencje DNA, pochodne SV40; plazmidy bakteryjne, fagi DNA, bakulowirusy, plazmidy drożdżowe, wektory pochodzące z połączeń plazmidów i fagów DNA, DNA wirusowe takie, jak ospy krowiej, adenowirusa, wirusa ospy drobiu i wścieklizny rzekomej. Wiele wektorów klonujących i ekspresyjnych do użycia z gospodarzami prokariotycznymi i eukariotycznymi zostało opisanych, na przykład, przez Sambrook. [0165] Poszczególne wektory bakteryjne, które mogą być stosowane, obejmują dostępne w handlu plazmidy zawierające elementy genetyczne znanego wektora klonującego pBR322 (ATCC 37017), pKK223-3 (Pharmacia Fine Chemicals, Uppsala, Szwecja), GEM1 (Promega Biotec, Madison, WI, USA) pQE70, pQE60, pQE-9 (Qiagen), PD 10, psiX174 pBluescript II KS, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene), ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia), pKK232-8 i pCM7. Szczególne eukariotyczne wektory obejmują pSV2CAT, pOG44, pXT1, pSG (Stratagene) pSVK3, pBPV, pMSG, i pSVL (Pharmacia). Niemniej jednak, można stosować każdy inny wektor, o ile ulega replikacji i utrzymuje się w komórce gospodarza. Komórki gospodarza i transformowane komórki [0166] Wynalazek zapewnia również transformowaną komórkę, zawierającą sekwencję kwasu nukleinowego według wynalazku, np. sekwencję kodującą fosfolipazę według wynalazku, wektor według wynalazku. Komórka gospodarza może oznaczać dowolną z komórek gospodarza znaną znawcy, w tym prokariotyczne komórki, eukariotyczne komórki takie, jak komórki bakteryjne, komórki grzybów, komórki drożdży, komórki ssacze, komórki owadzie lub komórki roślinne. Enzymy według wynalazku mogą być eksprymowane w -47- dowolnej komórce gospodarza, np. dowolnej komórce bakteryjnej, dowolnej komórce drożdży, np. Pichia pastoris, Saccharomyces cerevisiae lub Schizosaccharomyces pombe. Przykładowe komórki bakteryjne obejmują E. coli, Lactococcus lactis, Streptomyces, Bacillus subtilis, Bacillus cereus, Salmonella typhimurium lub różne gatunki w obrębie rodzajów Bacillus, Streptomyces i Staphylococcus. Przykładowe komórki owadzie obejmują Drosophilia S2 i Spodoptera Sf9. Przykładowe komórki zwierzęce obejmują CHO, COS lub Bowes melanoma lub dowolną mysią lub ludzką linię komórkową. Selekcja odpowiedniego gospodarza pozostaje w ramach umiejętności znawcy. [0167] Wektor można wprowadzać do komórek gospodarza przy użyciu dowolnej z szeregu technik, w tym transformacja, transfekcja, transdukcja, infekcja wirusowa, strzelby genowe lub przenoszenie genów za pośrednictwem Ti. Określone sposoby obejmują transfekcję fosforanem wapnia, transfekcję za pośrednictwem DEAE-dekstranu, lipofekcję lub elektroporację (Davis, L., Dibner, M., Battey, I., Basic Methods in Molecular Biology, (1986)). [0168] W stosownych przypadkach, zmodyfikowane komórki gospodarza mogą być hodowane w konwencjonalnych pożywkach odżywczych zmodyfikowanych w odpowiedni sposób do aktywacji promotorów, selekcji transformantów lub amplifikacji geny według ujawnienia. Po transformacji odpowiedniego szczepu gospodarza i wzrostu szczepu gospodarza do odpowiedniej gęstości komórkowej, wybrany promotor można indukować za pomocą odpowiednich środków (np. zmiana temperatury lub indukcja chemiczna) i komórki mogą być hodowane przez dodatkowy okres czasu w celu umożliwienia im wyprodukowania pożądanego polipeptydu lub jego fragmentu. [0169] Komórki mogą być zbierane przez wirowanie, rozerwanie środkami fizycznymi lub chemicznymi, i uzyskany surowy ekstrakt zatrzymuje się w celu dalszego oczyszczenia. Komórki mikrobiologiczne stosowane do ekspresji białek można rozerwać dowolnym dogodnym sposobem, w tym cyklami zamrażania-rozmrażania, ultradźwiękami, mechanicznym rozerwaniem, lub zastosowaniem środków komórkowej lizy. Takie metody są dobrze znane znawcom w dziedzinie. Wyeksprymowany polipeptyd lub jego fragment można odzyskiwać i oczyszczać z hodowli komórek rekombinowanych metodami obejmującymi wytrącanie siarczanem amonu lub etanolem, ekstrakcję kwasem, chromatografię anionowymienną lub kationowymienną, chromatografię na fosfocelulozie, chromatografię oddziaływań hydrofobowych, chromatografię powinowactwa, chromatografię na hydroksyapatycie oraz chromatografię lektynową. Etapy ponownego fałdowania białka mogą być stosowane, w razie potrzeby, dla zakończenia konfiguracji polipeptydu. W razie potrzeby, można wykorzystać wysokosprawną chromatografię cieczową (HPLC) dla końcowych etapów oczyszczania. [0170] Do ekspresji rekombinowanego białka można również zastosować różne układy do hodowli komórek ssaczych. Przykłady ssaczych układów ekspresyjnych obejmują linie COS7 małpich fibroblastów nerki i inne linie komórkowe zdolne do eksprymowania białka z kompatybilnego wektora takie, jak linie komórkowe C127, 3T3, CHO, HeLa i BHK. -48- [0171] Konstrukty w komórkach gospodarza mogą być użyte w konwencjonalny sposób w celu wytworzenia produktu genu kodowanego przez zrekombinowaną sekwencję. W zależności od gospodarza zastosowanego w procesie produkcyjnym rekombinowanego, polipeptydy wytwarzane przez komórki gospodarza zawierające wektor mogą być glikozylowane lub mogą nie być glikozylowane. Polipeptydy według wynalazku mogą zawierać lub mogą nie zawierać także początkowej reszty aminokwasowej metioniny. [0172] Układy translacji bezkomórkowych mogą być również stosowane do wytwarzania polipeptydu według wynalazku. Układy translacji bezkomórkowych mogą wykorzystać mRNA transkrybowany z konstruktu DNA zawierającego promotor funkcjonalnie połączony z kwasem nukleinowym kodującym polipeptyd lub jego fragment. W niektórych aspektach, konstrukt DNA może być zlinearyzowany przed przeprowadzeniem reakcji transkrypcji in vitro. Transkrybowany mRNA inkubuje się następnie z odpowiednim ekstraktem z translacji bezkomórkowej takim, jak ekstrakt retikulocytów królika, z wytworzeniem żądanego polipeptydu lub jego fragmentu. [0173] Wektory ekspresyjne mogą zawierać jeden lub więcej genów markerów podlegających selekcji aby zapewnić cechę fenotypową dla selekcji stransformowanych komórek gospodarza taką, jak oporność na reduktazę dihydrofolianową lub neomycynę dla hodowli komórek eukariotycznych, albo taką, jak odporność na tetracyklinę lub ampicylinę w E. coli. [0174] Przykładowy enzym fosfolipaza C (o sekwencji jak podano w SEQ ID NO:2) ulega nadmiernej ekspresji w aktywnej postaci w różnych układach gospodarzy obejmujących Gram-ujemne bakterie takie, jak E. coli, Gram-dodatnie bakterie takie, jak dowolne Bacillus sp.(np. Bacillus subtilis, Bacillus cereus), komórki gospodarza drożdży (w tym, np. Pichia pastoris, Saccharomyces sp. takie, jak S. cerevisiae i S. pombe) oraz Lactococcus lactis, lub komórki ssacze, grzybicze, roślinne lub owadzie. Aktywny enzym ulega ekspresji z różnych konstruktów w każdym układzie gospodarza. Te konstrukty ekspresyjne kwasu nukleinowego mogą zawierać nukleotydy kodujące pełnej długości otwartą ramkę odczytu (złożoną z sekwencji sygnałowej, pro-sekwencji i sekwencji kodującej dojrzałe białko) lub mogą zawierać podzbiór tych elementów genetycznych, albo same, albo w połączeniu z heterologicznymi elementami genetycznymi, które służą jako sekwencja sygnałowa i/lub prosekwencja dla dojrzałej otwartej ramki odczytu. Każdy z tych układów może służyć jako gospodarz do komercyjnej produkcji dla ekspresji PLC do zastosowania w opisanych powyżej enzymatycznych sposobach odśluzowania oleju. Amplifikacja Kwasów Nukleinowych [0175] W praktykowaniu wynalazku kwasy nukleinowe kodujące polipeptydy według wynalazku lub modyfikowane kwasy nukleinowe, mogą być odtwarzane za pomocą, np. amplifikacji. Ujawnienie zapewnia pary sekwencji starterów do amplifikacji do namnażania kwasów nukleinowych kodujących polipeptydy o aktywności fosfolipazy. W jednym aspekcie, pary starterów są w stanie amplifikować sekwencje kwasów nukleinowych według ujawnienia, np. w tym przykładowe SEQ ID NO:1, lub jej podsekwencję; sekwencję jak podaną w SEQ ID NO:3, lub jej podsekwencję; sekwencję jak podano w SEQ ID NO:5, lub -49- jej podsekwencję; i, sekwencję jak podano w SEQ ID NO:7, lub jej podsekwencję, itd. Znawca może zaprojektować pary sekwencji starterów do amplifikacji dla dowolnej części lub pełnej długości tych sekwencji. [0176] Ujawnienie zapewnia parę sekwencji starterów do amplifikacji dla amplifikacji kwasu nukleinowego kodującego polipeptyd mający aktywność fosfolipazy, przy czym para starterów jest zdolna do amplifikacji kwasu nukleinowego zawierającego sekwencję według wynalazku, lub jej fragmenty lub podsekwencje. Jeden lub każdy element pary sekwencji starterów do amplifikacji może zawierać oligonukleotyd zawierający co najmniej około 10 do 50 kolejnych zasad w sekwencji, lub około 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, lub 25 kolejnych zasad w sekwencji. [0177] Ujawnienie zapewnia pary starterów do amplifikacji, przy czym para starterów zawiera pierwszy element mający sekwencję, jak określono przez około pierwsze (5?) 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, lub 25 reszt kwasu nukleinowego według wynalazku, i drugi element mający sekwencję, jak określono przez około pierwsze (5?) 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, lub 25 reszt nici komplementarnej pierwszego elementu. Ujawnienie zapewnia fosfolipazy wytwarzane przez amplifikację, np. reakcję łańcuchową polimerazy (PCR), przy użyciu pary starterów do amplifikacji według ujawnienia. Ujawnienie zapewnia sposoby wytwarzania fosfolipazy przez amplifikację, np. reakcję łańcuchową polimerazy (PCR), przy użyciu pary starterów do amplifikacji według ujawnienia. W jednym aspekcie, para starterów do amplifikacji amplifikuje kwas nukleinowy z biblioteki, np. biblioteki genów takich, jak biblioteka środowiskowa. [0178] Reakcje amplifikacji można również stosować do ilościowego określania ilości kwasu nukleinowego w próbce (taka, jak ilość informacji w próbce komórkowej), znacznika kwasu nukleinowego (np. aby zastosować go do macierzy lub blota), wykrywania kwasu nukleinowego, lub ilościowego oznaczenia określonego kwasu nukleinowego w próbce. W jednym aspekcie według ujawnienia, informację wyizolowaną z komórek lub biblioteki cDNA amplifikuje się. Znawca może wybrać i zaprojektować odpowiednie startery oligonukleotydowe do amplifikacji. Metody amplifikacji są dobrze znane w dziedzinie i obejmują, np. reakcją łańcuchową polimerazy, PCR (patrz, np. PCR PROTOCOLS, A GUIDE TO METHODS AND APPLICATIONS, ed. Innis, Academic Press, N.Y. (1990) i PCR STRATEGIES (1995), ed. Innis, Academic Press, Inc., N.Y., reakcję łańcuchową ligazy (LCR) (patrz, np. Wu (1989) Genomics 4:560; Landegren (1988) Science 241:1077; Barringer (1990) Gene 89:117); amplifikację transkrypcji (patrz, np. Kwoh (1989) Proc. Natl. Acad. Sci. USA 86:1173); i, samowystarczalną replikację sekwencji (patrz, np. Guatelli (1990) Proc. Natl. Acad. Sci. USA 87:1874); amplifikację replikazą Q Beta (patrz, np. Smith (1997) J. Clin. Microbiol. 35:1477-1491), zautomatyzowany test amplifikacji z replikazą Qbeta (patrz, np. Burg (1996) Mol. Cell. Probes 10:257-271) oraz inne techniki, w których pośredniczy polimeraza RNA (np. NASBA, Cangene, Mississauga, Ontario); zobacz też Berger (1987) Methods Enzymol. 152:307-316; Sambrook; Ausubel; Patent US Nry 4,683,195 i 4,683,202; Sooknanan (1995) Biotechnology 13:563-564. Określanie stopnia identyczności sekwencji -50- [0179] Ujawnienie zapewnia wyizolowane i rekombinowane kwasy nukleinowe zawierające sekwencje mające co najmniej około 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do przykładowego kwasu nukleinowego według ujawnienia (np. SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, SEQ ID NO:71, SEQ ID NO:73, SEQ ID NO:75, SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:91, SEQ ID NO:93, SEQ ID NO:95, SEQ ID NO:97, SEQ ID NO:99, SEQ ID NO:101, SEQ ID NO:103, SEQ ID NO:105, SEQ ID NO:107, SEQ ID NO:109, SEQ ID NO:111, SEQ ID NO:113, SEQ ID NO:115, SEQ ID NO:117, SEQ ID NO:119, SEQ ID NO:121, SEQ ID NO:123, SEQ ID NO:125, SEQ ID NO:127, SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ ID NO:135, SEQ ID NO:137, SEQ ID NO:139, SEQ ID NO:141, SEQ ID NO:143, SEQ ID NO:145, SEQ ID NO:147, SEQ ID NO:149, SEQ ID NO:151, SEQ ID NO:153, SEQ ID NO:155, SEQ ID NO:157, SEQ ID NO:159, SEQ ID NO:161, SEQ ID NO:163, SEQ ID NO:165, SEQ ID NO:167, SEQ ID NO:169, SEQ ID NO:171 lub SEQ ID NO:173, i kwasy nukleinowe kodujące SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:74, SEQ ID NO:76, SEQ ID NO:78, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, SEQ ID NO:92, SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:102, SEQ ID NO:104, SEQ ID NO:106, SEQ ID NO:108 SEQ ID NO:110, SEQ ID NO:112, SEQ ID NO:114, SEQ ID NO:116, SEQ ID NO:118, SEQ ID NO:120, SEQ ID NO:122, SEQ ID NO:124, SEQ ID NO:126, SEQ ID NO:128, SEQ ID NO:130, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:136, SEQ ID NO:38; SEQ ID NO:140; SEQ ID NO:142; SEQ ID NO:144; NO:146, SEQ ID NO:148, SEQ ID NO:150, SEQ ID NO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ ID NO:168, SEQ ID NO:170 SEQ ID NO:172, lub SEQ ID NO:174) na regionie co najmniej około 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550 lub więcej, reszt. Wynalazek zapewnia polipeptydy zawierające sekwencję -51- wykazującą co najmniej około 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji do przykładowego polipeptydu według wynalazku. Zakres identyczności sekwencji (homologii) można wyznaczyć przy użyciu dowolnego programu komputerowego i powiązanych parametrów, w tym tych tu opisanych takich, jak BLAST 2.2.2. lub FASTA wersja 3.0t78, z domyślnymi parametrami. W alternatywnych przykładach wykonania identyczność sekwencji może rozciągać się na regionie co najmniej około 5, 10, 20, 30, 40, 50, 1 00, 150, 200, 250, 300, 350, 400 kolejnych reszt, lub pełnej długości kwasu nukleinowego lub polipeptydu. Zakres identyczności sekwencji (homologii) można wyznaczyć przy użyciu dowolnego programu komputerowego i powiązanych parametrów, w tym tych tu opisanych takich, jak BLAST 2.2.2. lub FASTA wersja 3.0t78, z domyślnymi parametrami. [0180] Figura 11 do wykres opisujący wybrane cechy przykładowych kwasów nukleinowych i polipeptydów według ujawnienia, w tym porównanie identyczności sekwencji przykładowych sekwencji z publicznymi bazami danych. Wszystkie sekwencje opisane na Figurze 11 zostały poddane przeszukiwaniu BLAST (jak opisano szczegółowo, poniżej) wobec dwóch zestawów baz danych. Pierwszy zestaw baz danych jest dostępny za pośrednictwem NCBI (National Center for Biotechnology Information). Wszystkie wyniki z przeszukiwań względem tych baz danych są zamieszczone w kolumnach o nazwie ?Opis NR?, ?Kod akcesyjny NR?, ?Wartość E NR? lub ?Organizm NR?. ?NR? dotyczy nieredundantnej nukleotydowej bazy danych prowadzonej przez NCBI. Ta baza danych stanowi kompozyt GenBank, uaktualnień GenBank i uaktualnień EMBL. Wpisy w kolumnie ?Opis NR? dotyczą linii definicji w dowolnym danym zapisie NCBI, który obejmuje opis sekwencji taki, jak źródło organizmu, nazwa genu/nazwa białka, lub jakiś opis of funkcji sekwencji. Wpisy w kolumnie ?Kod akcesyjny NR? dotyczą unikatowego identyfikatora nadanego zapisowi sekwencji. Wpisy w kolumnie ?Wartość E NR? dotyczą spodziewanej wartości (wartość E; ang. expect value), która przedstawia prawdopodobieństwo, że wynik dopasowania określony dla sekwencji kwerendy (sekwencje według ujawnienia) i sekwencji z bazy danych zostanie znaleziony w tej samej liczbie porównań pomiędzy 50 losowymi sekwencjami, jak wykonano w bieżącym przeszukiwaniu BLAST. Wpisy w kolumnie ?Organizm NR? dotyczą źródła organizmu dla sekwencji zidentyfikowanej jako najbliższe trafienie BLAST. Drugi zestaw baz danych jest zbiorczo znany jako baza danych Geneseq?, która jest dostępna poprzez Thomson Derwent (Philadelphia, PA). Wszystkie wyniki z przeszukiwań względem tej bazy danych znajdują się w kolumnach o nazwach ?Geneseq ? Opis białka?, ?Geneseq ? Kod akcesyjny białka?, ?Geneseq ? Wartość e białka?, ?Geneseq ? Opis DNA?, ?Geneseq ? Kod akcesyjny DNA? lub ?Geneseq ? Wartość e DNA?. Informacja znajdująca się w tych kolumnach jest porównywalna do informacji znajdowanej w kolumnach NR opisanych powyżej, za wyjątkiem tego, że pochodzi z przeszukiwań BLAST względem bazy danych Geneseq? zamiast bazy danych NCBI. Dodatkowo, tabela ta zawiera kolumnę ?Prognozowany numer EC?. Numer EC oznacza numer przypisany do typu enzymu według schematu standaryzowanej nomenklatury enzymów opracowanej przez Enzyme Commission of the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUBMB). Wyniki w kolumnie ?Prognozowany numer EC? wyznacza się za pomocą -52- przeszukiwania BLAST względem bazy danych Kegg (Kyoto Encyclopedia of Genes and Genomes). Jeśli najpełniejsze trafienie BLAST ma wartość e równą lub mniejszą niż e-6, numer EC przypisany do najpełniejszego trafienia jest wprowadzany do tabeli. Numer EC głównego trafienia jest stosowany jako wskazówka dotycząca tego, jaki mógłby być numer EC sekwencji według ujawnienia. Kolumny ?Długość DNA kwerendy? i ?Długość białka kwerendy? dotyczą odpowiednio liczby nukleotydów lub liczby aminokwasów w sekwencji według ujawnienia, którą przeszukiwano lub stosowano jako kwerendę względem baz danych NCBI lub Geneseq. Kolumny ?Geneseq lub NR Długość DNA? i ?Geneseq lub NR Długość białka? dotyczą odpowiednio liczby nukleotydów lub liczby aminokwasów w sekwencji najpełniejszego trafienia z przeszukiwania BLAST. Wyniki zapewnione w tych kolumnach pochodzą z wyników przeszukiwań, które dały niższą wartość e niż te dla bazy danych NCBI lub bazy danych Geneseq. Kolumny ?Geneseq lub NR Identyfikator % białka? i ?Geneseq lub NR Identyfikator % DNA? dotyczą procentowej identyczności sekwencji pomiędzy sekwencją według wynalazku i sekwencją głównego trafienia BLAST. Wyniki zapewnione w tych kolumnach pochodzą z wyników przeszukiwań, które dały niższą wartość e niż te dla bazy danych NCBI lub bazy danych Geneseq. [0181] Sekwencje homologiczne obejmują również sekwencje RNA, w których urydyny zastąpiły tyminy w sekwencjach kwasu nukleinowego. Sekwencje homologiczne można otrzymać przy użyciu dowolnych opisanych tu procedur lub mogą być wynikiem korekty błędu w sekwencjonowaniu. Należy zauważyć, że sekwencje kwasu nukleinowego jak podano w opisie mogą być przedstawione w tradycyjnym formacie jednoznakowym (patrz np. Stryer, Lubert. Biochemistry, wydanie trzecie, W. H Freeman & Co., New York) lub w dowolnym innym formacie, który zapisuje identyczność nukleotydów w sekwencji. [0182] Stosuje się różne programy do porównywania sekwencji, zidentyfikowane w opisie, w tym aspekcie według wynalazku. Identyczność sekwencji białka i/lub sekwencji kwasu nukleinowego (homologie) można oceniać przy użyciu dowolnego z szeregu algorytmów do porównywania sekwencji i programów znanych ze stanu techniki. Takie algorytmy i programy obejmują, w sposób nieograniczający, TBLASTN, BLASTP, FASTA, TFASTA, i CLUSTALW (Pearson i Lipman, Proc. Natl. Acad. Sci. USA 85(8):2444-2448, 1988; Altschul i wsp., J. Mol. Biol. 215(3):403-410, 1990; Thompson i wsp., Nucleic Acids Res. 22(2):4673-4680, 1994; Higgins i wsp., Methods Enzymol. 266:383-402, 1996; Altschul i wsp., J. Mol. Biol. 215(3):403-410, 1990; Altschul i wsp., Nature Genetics 3:266-272, 1993). [0183] Homologię lub identyczność można mierzyć przy użyciu oprogramowania do analizy sekwencji (np. pakiet oprogramowania do analizy sekwencji Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, WI 53705). Takie oprogramowanie dopasowuje podobne sekwencje przez przypisywanie stopni homologii różnym delecjom, substytucjom i innym modyfikacjom. Określenia ?homologia? i ?identyczność? w kontekście dwóch lub więcej sekwencji kwasów nukleinowych lub polipeptydów, dotyczą dwóch lub więcej sekwencji lub podsekwencji, które są takie same lub mają określony odsetek reszt aminokwasowych lub nukleotydów, które są takie same przy porównywaniu i dopasowaniu z maksimum zgodności -53- w ramach okna porównywania lub wyznaczonego obszaru, jak zmierzono przy użyciu dowolnej liczby algorytmów do porównywania sekwencji lub przez ręczne dopasowywanie i sprawdzanie wizualne. Przy porównywaniu sekwencji jedna sekwencja może funkcjonować jako sekwencja referencyjna (przykładowa sekwencja SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, itd.), do której porównuje się sekwencje testowane. Przy stosowaniu algorytmu do porównywania sekwencji, sekwencje testowana i referencyjna są wprowadzane do komputera, oznacza się koordynaty podsekwencji, o ile jest to konieczne, i oznacza się parametry programu algorytmu sekwencji. Można stosować domyślne parametry programu lub wyznaczać alternatywne parametry. Algorytm do porównywania sekwencji następnie wylicza procent identyczności sekwencji dla testowanych sekwencji względem sekwencji referencyjnej, w oparciu o parametry programu. [0184] Stosowane tu ?okno porównywania? obejmuje odniesienie do odcinka dowolnej z liczby sąsiadujących reszt. Na przykład, w alternatywnych aspektach według ujawnienia, sąsiadujące reszty począwszy w dowolnym miejscu od 20 do pełnej długości przykładowej sekwencji według ujawnienia, np. SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, itd., są porównywane do sekwencji referencyjnej o tej samej liczbie sąsiadujących pozycji po optymalnym dopasowaniu dwóch sekwencji. Jeśli sekwencja referencyjna ma wymaganą identyczność sekwencji do przykładowej sekwencji według ujawnienia, np. 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do sekwencji według ujawnienia, np. SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, itd., że sekwencja jest w zakresie ujawnienia. W alternatywnych przykładach wykonania, podsekwencje mające od około 20 do 600, około 50 do 200, i około 100 do 150 są porównywane do sekwencji referencyjnej o tej samej liczbie sąsiadujących pozycji po optymalnym dopasowaniu dwóch sekwencji. Sposoby dopasowywania sekwencji do celów porównań są dobrze znane ze stanu techniki. Optymalne dopasowanie sekwencji do porównań można przeprowadzać, np. za pomocą lokalnego algorytmu do homologii według Smith & Wodaman, Adv. Appl. Math. 2:482, 1981, za pomocą algorytmu do dopasowania homologii według Needleman & Wunsch, J. Mol. Biol. 48:443, 1970, sposobem przeszukiwań pod kątem podobieństwa według Person & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444, 1988, przez komputerowe implementacje tych algorytmów (GAP, BESTFIT, FASTA, i TFASTA w Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), lub przez ręczne dopasowywanie i sprawdzanie wizualne. Inne algorytmy do określania homologii lub identyczności obejmują, na przykład, oprócz programu BLAST (Basic Local Alignment Search Tool z National Center for Biological Information), ALIGN, AMAS (Analysis of Multiply Aligned Sequences), AMPS (Protein Multiple Sequence Alignment), ASSET (Aligned Segment Statistical Evaluation Tool), BANDS, BESTSCOR, BIOSCAN (Biological Sequence Comparative Analysis Node), BLIMPS (BLocks IMProvedSearcher), -54- FASTA, Intervals & Points, BMB, CLUSTAL V, CLUSTAL W, CONSENSUS, LCONSENSUS, WCONSENSUS, algorytm Smitha-Wodamana, DARWIN, algorytm Las Vegas, FNAT (Forced Nucleotide Alignment Tool),), Framealign, Framesearch, DYNAMIC, FILTER, FSAP (Fristensky Sequence Analysis Package), GAP (Global Alignment Program), GENAL, GIBBS, GenQuest, ISSC (Sensitive Sequence Comparison), LALIGN (Local Sequence Alignment), LCP (Local Content Program), MACAW (Multiple Alignment Construction & Analysis Workbench), MAP (Multiple Alignment Program), MBLKP, MBLKN, PIMA (Pattern-Induced Multi-sequence Alignment), SAGA (Sequence Alignment by Genetic Algorithm) i WHAT-IF. Takie programy do dopasowania można również stosować do przeszukiwań przesiewowych genomowych baz danych, w celu identyfikacji sekwencji polinukleotydów mających zasadniczo identyczne sekwencje. Dostępny jest szereg genomowych baz danych, na przykład, dostępna jest znaczna część ludzkiego genomu, jako część Human Genome Sequencing Project (Gibbs, 1995). Zsekwencjonowano kilka genomów, np. M. genitalium (Fraser i wsp., 1995), M. jannaschii (Bult i wsp., 1996), H. influenzae (Fleischmann i wsp., 1995), E. coli (Blattner i wsp., 1997), drożdży (S. cerevisiae) (Mewes i wsp., 1997), oraz D. melanogaster (Adams i wsp., 2000). Poczyniono istotny postęp w sekwencjonowaniu genomów modelowych organizmów takich, jak mysz, C. elegans, i Arabadopsis sp. Różne organizacje prowadzą bazy danych zawierające genomowe informacje z przypisanymi pewnymi informacjami funkcjonalnymi, i są one dostępne przez Internet. [0185] Algorytmy BLAST, BLAST 2.0 i BLAST 2.2.2 są również stosowane do wykonania wynalazku. Opisane są, np. w Altschul (1977) Nuc. Acids Res. 25:3389-3402; Altschul (1990) J. Mol. Biol. 215:403-410. Oprogramowanie do wykonywania analiz BLAST jest publicznie dostępne za pośrednictwem National Center for Biotechnology Information. Ten algorytm wiąże się najpierw z identyfikowaniem par sekwencji dających wysoką punktację, (HSPs), przez identyfikowanie krótkich fraz o długości W sekwencji kwerendy, które pasują lub spełniają pewne kryterium progowe o dodatniej wartości T podczas dopasowywania do frazy o tej samej długości w bazie danych sekwencji. T jest określane jako próg wyniku sąsiedztwa dla frazy (Altschul (1990) supra). Te wyjściowe trafienia sąsiedztwa dla frazy działają jako zarodek do inicjalizacji przeszukiwań w celu znalezienia dłuższych, zawierających je HSP. Trafienia dla frazy rozciąga się w obydwu kierunkach wzdłuż każdej sekwencji, tak daleko, jak tylko da się podwyższyć kumulacyjny wynik dopasowania. Wyniki kumulacyjne są obliczane przy użyciu, dla sekwencji nukleotydowych, parametrów M (wynik ? nagroda dla pary dopasowanych reszt; zawsze >0). Dla sekwencji aminokwasowych stosuje się macierz punktującą do wyliczania wyniku kumulacyjnego. Przedłużenie trafień dla frazy w każdym z kierunków podlega zatrzymaniu, gdy: kumulacyjny wynik dopasowania obniża się o ilość X z maksymalnej osiąganej wartości; wynik kumulacyjny spada do zero lub poniżej, ze względu na akumulację jednego lub więcej dopasowań reszt o wyniku ujemnym; lub po osiągnięciu końca którejkolwiek z sekwencji. Parametry W, T, i X algorytmu BLAST określają czułość i szybkość dopasowania. Program BLASTN (do sekwencji nukleotydowych) stosuje jako domyślne długość frazy (W) 11, prognozowanie (E) 10, M=5, N=-4 i porównanie obu nici. Dla sekwencji aminokwasowych, program BLASTP stosuje jako domyślne długość frazy 3, i prognozowanie (E) 10, i macierz punktującą BLOSUM62 (patrz -55- Henikoff & Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915) dopasowania (B) 50, prognozowanie (E) 10, M=5, N= -4, i porównanie obu nici. Algorytm BLAST wykonuje również analizę statystyczną podobieństwa pomiędzy dwoma sekwencjami (patrz np. Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873). Jedną z miar podobieństwa, zapewnianą przez algorytm BLAST jest najmniejsza suma prawdopodobieństwa (P(N)), która zapewnia wskazanie dotyczące prawdopodobieństwa, z którym dopasowanie pomiędzy dwoma sekwencjami nukleotydowymi lub aminokwasowymi mogłoby zaistnieć przypadkowo. Na przykład, kwas nukleinowy jest uważany za podobny do referencyjnej sekwencji, jeśli najmniejsza suma prawdopodobieństwa w porównaniu testowanego kwasu nukleinowego do referencyjnego kwasu nukleinowego wynosi mniej niż około 0,2, bardziej korzystnie mniej niż około 0,01, i najbardziej korzystnie mniej niż około 0,001. W jednym aspekcie, homologię sekwencji białka i sekwencji kwasu nukleinowego ocenia się przy użyciu Basic Local Alignment Search Tool (?BLAST?). Na przykład, można stosować pięć specyficznych programów BLAST do wykonania poniższego zadania: (1) BLASTP i BLAST3 porównują sekwencję aminokwasową kwerendy z białkową sekwencją z bazy danych; (2) BLASTN porównuje sekwencję nukleotydową kwerendy z sekwencją nukleotydową z bazy danych; (3) BLASTX porównuje w sześciu ramkach odczytu konceptualne produkty translacji sekwencji nukleotydowej kwerendy (obie nici) z sekwencją białkową z bazy danych; (4) TBLASTN porównuje sekwencję białkową kwerendy z sekwencją nukleotydową z bazy danych po translacji we wszystkich sześciu ramkach odczytu (obie nici); oraz (5) TBLASTX porównuje translację w sześciu ramkach odczytu sekwencji nukleotydowej kwerendy z translacją w sześciu ramkach odczytu sekwencji nukleotydowej z bazy danych. Programy BLAST identyfikują sekwencje homologiczne przez identyfikowanie podobnych odcinków, które są nazywane w opisie jako ?pary odcinków o wysokiej punktacji,? pomiędzy sekwencją aminokwasową lub sekwencją kwasu nukleinowego kwerendy i testową sekwencją, którą korzystnie otrzymuje się z baz danych sekwencji białka lub sekwencji kwasu nukleinowego. Pary odcinków o wysokiej punktacji są korzystnie identyfikowane (tj. dopasowywane) za pomocą macierzy punktujących, których wiele jest znane ze stanu techniki. Korzystnie, stosowaną macierzą punktującą jest macierz BLOSUM62 (Gonnet i wsp., Science 256:1443-1445, 1992; Henikoff i Henikoff, Proteins 17:49-61, 1993). Mniej korzystnie, można również stosować macierze PAM lub PAM250 (patrz np. Schwartz i Dayhoff, eds., 1978, Matrices for Detecting Distance Relationships: Atlas of Protein Sequence and Structure, Washington: National Biomedical Research Foundation). [0186] W jednym aspekcie według ujawnienia, aby ustalić, czy kwas nukleinowy ma wymaganą identyczność sekwencji, by mieścić się w zakresie wynalazku stosuje się programy NCBI BLAST 2.2.2. Domyślne opcje to blastp. Istnieje około 38 opcji ustawień w programie BLAST 2.2.2. W tym przykładowym aspekcie ujawnienia, stosuje się wszystkie wartości domyślne za wyjątkiem domyślnych ustawień filtrowania (tj. wszystkie parametry są ustawione jako domyślne poza filtrowaniem, które jest ustawione na OFF); zamiast tego stosuje się ustawienie ?-F F?, które unieruchamia filtrowanie. Stosowanie domyślnych -56- ustawień filtrowania często powoduje naruszenia Karlina-Altschula ze względu na małą długość sekwencji. [0187] Wartości domyślne stosowane w tym przykładowym aspekcie ujawnienia, i do wyznaczania wartości na figurze 11, jak omówiono powyżej, obejmują: ?Filter for low complexity: ON > Word Size: 3 > Matrix: Blosum62 > Gap Costs: Existence:11 > Extension: 1? Inne domyślne ustawienia to: filter for low complexity OFF, word size 3 for protein, BLOSUM62 matrix, gap existence penalty -11 i gap extension penalty -1. [0188] Przykładowe ustawienia programu NCBI BLAST 2.2.2 są podane w przykładzie 1, poniżej. Należy zauważyć, że opcja ?-W? wynosi domyślnie 0. Oznacza to, że, o ile nie zmieni się ustawień, domyślny rozmiar frazy wynosi 3 dla białek i 11 dla nukleotydów. Systemy komputerowe i produkty programy komputerowe [0189] Aby wyznaczyć i zidentyfikować identyczności sekwencji, strukturalne homologie, motywy i podobieństwa in silico, sekwencje polipeptydu lub kwasu nukleinowego według wynalazku można przechowywać, zapisywać i poddawać operacjom na dowolnym nośniku, który może być odczytywany i dostępny przez komputer. Stosownie do tego, ujawnienie zapewnia komputery, systemy komputerowe, nośniki odczytywalne komputerowo, produkty programy komputerowe i podobne, mające zapisane lub zachowane w swojej pamięci sekwencje kwasu nukleinowego i polipeptydów według ujawnienia, np. przykładowej sekwencji według ujawnienia, np. SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, itd. Stosowane tu wyrazy ?zapisane? i ?zachowane? dotyczą sposobu przechowywania informacji na nośniku komputerowym. Znawca może łatwo przystosować dowolne znane sposoby do zapisywania informacji na nośniku odczytywalnym komputerowo, w celu wygenerowania produktów zawierających jedną lub więcej sekwencji kwasu nukleinowego i/lub polipeptydów według wynalazku. [0190] Innym aspektem według ujawnienia jest nośnik odczytywalny komputerowo z zapisaną na nim co najmniej jedną sekwencją kwasu nukleinowego i/lub polipeptydową według ujawnienia. Nośniki odczytywalne komputerowo obejmują nośniki odczytywalne magnetycznie, nośniki odczytywalne optycznie, nośniki odczytywalne elektronicznie, nośniki magnetyczne/optyczne, pamięci flash. Na przykład, nośniki odczytywalne komputerowo mogą oznaczać dysk twardy, dyskietkę, taśmę magnetyczną, pamięć flash, CD-ROM, uniwersalną płytę wideo (DVD), pamięć o dostępie bezpośrednim (RAM) lub pamięć tylko do odczytu (ROM), lub dowolny rodzaj nośnika znany znawcy. -57- [0191] Ujawnienie obejmuje także systemy (np. systemy na bazie Internetu), szczególnie systemy komputerowe, które przechowują i wykonują operacje na sekwencjach i informacjach w sekwencjach jak tu opisanych. Jeden przykład systemu komputerowego 100 jest zilustrowany na schemacie blokowym na Figurze 1. Jak tu stosowany, ?system komputerowy? dotyczy elementów sprzętu, elementów oprogramowania, i elementów przechowywania danych, stosowanych do analizowania sekwencji nukleotydowych lub sekwencji polipeptydu według wynalazku. System komputerowy 100 może zawierać procesor do obróbki, uzyskiwania dostępu i wykonywania operacji na danych sekwencji. Procesor 105 może oznaczać dowolny dobrze znany typ jednostki centralnej taki, jak, na przykład, Pentium III z Intel Corporation, lub podobny procesor z Sun, Motorola, Compaq, AMD lub International Business Machines. System komputerowy 100 do system ogólnego przeznaczenia, który zawiera procesor 105 i jeden lub więcej wewnętrznych elementów do przechowywania danych 110 dla przechowywania danych, i jedno lub więcej urządzeń do odzyskiwania danych, dla odzyskiwania danych przechowywanych na elementach do przechowywania danych. Znawca może z łatwością rozstrzygnąć, czy jakiekolwiek z dostępnych obecnie systemów komputerowych są odpowiednie. [0192] System komputerowy 100 zawiera procesor 105 podłączony do magistrali, która jest podłączona do pamięci operacyjnej 115 (korzystnie realizowanej jako RAM) i jedno lub więcej wewnętrznych urządzeń do przechowywania danych 110 takich, jak napęd dysku twardego i/lub inne nośniki odczytywalne komputerowo, mające dane zapisane na nich. System komputerowy 100 może dodatkowo zawierać jedno lub więcej urządzenie do odzyskiwania danych 118 do odczytywania danych przechowywanych na wewnętrznych urządzeniach do przechowywania danych 110. [0193] Urządzenie do odzyskiwania danych 118 może oznaczać, na przykład, stację dysków, stację płyt kompaktowych, napęd taśm magnetycznych lub modem zdolny do podłączenia do zdalnego systemu do przechowywania danych (np. przez Internet) itd. W niektórych przykładach wykonania wewnętrzne urządzenie do przechowywania danych 110 oznacza usuwalny nośnik odczytywalny komputerowo taki, jak dyskietka, płyta kompaktowa, taśma magnetyczna itd. zawierający sterujący układ logiczny i/lub zapisane tam dane. System komputerowy 100 może korzystnie zawierać lub zostać zaprogramowany przez odpowiednie oprogramowanie do odczytywania układu logicznego sterującego i/lub danych z elementu do przechowywania danych, po wprowadzeniu do urządzenia do odzyskiwania danych. [0194] System komputerowy 100 zawiera wyświetlacz 120, który jest stosowany do wyświetlania użytkownikowi komputera danych wyjściowych. Należy również dostrzec, że system komputerowy 100 może być połączony z innymi systemami komputerowymi 125a-c w sieci lub rozległej sieci komputerowej, aby zapewniać scentralizowany dostęp do systemu komputerowego 100. Oprogramowanie do uzyskiwania dostępu i obróbki sekwencji nukleotydowych lub aminokwasowych według wynalazku może podczas wykonywania być w pamięci operacyjnej 115. [0195] W pewnych aspektach, system komputerowy 100 może dodatkowo zawierać algorytm do porównywania sekwencji, do porównywania sekwencji kwasu nukleinowego według -58- wynalazku. Algorytm i sekwencje można przechowywać na nośniku odczytywalnym komputerowo. ?Algorytm do porównywania sekwencji? dotyczy jednego lub więcej programów, które są implementowane (lokalnie lub zdalnie) na systemie komputerowym 100, do porównywania sekwencji nukleotydowej z innymi sekwencjami nukleotydowymi i/lub związkami przechowywanymi w zasobach do przechowywania danych. Na przykład, algorytm do porównywania sekwencji może porównywać sekwencje nukleotydowe przykładowej sekwencji, np. np. SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, itd., przechowywanej na nośniku odczytywalnym komputerowo do referencyjnych sekwencji przechowywanych na nośniku odczytywalnym komputerowo, aby zidentyfikować homologie lub motywy strukturalne. [0196] Parametry stosowane z powyższymi algorytmami można dostosowywać w zależności od długości sekwencji i stopnia badanej homologii. W pewnych aspektach, parametry mogą oznaczać domyślne parametry stosowane przez algorytmy pod nieobecność instrukcji od użytkownika. Figura 2 to schemat przepływowy ilustrujący jeden aspekt procesu 200 do porównywania nowej sekwencji nukleotydu lub białka z bazą danych sekwencji, w celu określenia poziomu homologii pomiędzy nową sekwencją i sekwencjami w bazie danych. Baza danych sekwencji może oznaczać prywatną bazę danych przechowywaną w obrębie systemu komputerowego 100, lub publiczną bazę danych taką, jak GENBANK, która jest dostępna przez Internet. Proces 200 rozpoczyna się w punkcie startu 201 i następnie przechodzi do stanu 202, w którym nowa sekwencja do porównania jest przechowywana w pamięci w systemie komputerowym 100. Jak omówiono powyżej, pamięć może oznaczać dowolny typ pamięci, w tym RAM lub wewnętrzne urządzenie pamięci. [0197] Proces 200 następnie przechodzi do stanu 204 w którym baza danych sekwencji jest otwierana do celów analizy i porównań. Proces 200 przechodzi następnie do stanu 206, w którym pierwsza sekwencja przechowywana w bazie danych jest wczytywana do pamięci na komputerze. Następnie wykonuje się porównanie w stanie 210, aby określić czy pierwsza sekwencja jest taka sama jak druga sekwencja. Co ważne, należy zauważyć, że ten etap nie jest ograniczony do wykonywania dokładnego porównania pomiędzy nową sekwencją i pierwszą sekwencją w bazie danych. Znawca zna dobrze znane sposoby porównywania dwóch sekwencji nukleotydowych lub białka, nawet jeśli nie są one identyczne. Na przykład, można wprowadzać luki do jednej sekwencji, w celu podwyższania poziomu homologii pomiędzy dwoma testowanymi sekwencjami. Parametry, które kontrolują, czy wprowadza się luki lub inne cechy do sekwencji podczas porównania są normalnie wprowadzane przez użytkownika systemu komputerowego. [0198] Po wykonaniu porównania dwóch sekwencji w stanie 210, ustala się, w stanie decyzji 210 czy dwie sekwencje są takie same. Oczywiście, określenie ?takie same? nie ogranicza się do sekwencji, które są absolutnie identyczne. Sekwencje, które mieszczą się w obrębie parametrów homologii wprowadzonych przez użytkownika zostaną oznaczone jako ?takie same? w procesie 200. Jeżeli ustali się, że dwie sekwencje są takie same, proces 200 przechodzi do stanu 214, w którym nazwa sekwencji z bazy danych jest wyświetlana -59- użytkownikowi. Ten stan powiadamia użytkownika, że sekwencja o wyświetlanej nazwie spełnia ograniczenia co do homologii, które zostały wprowadzone. Po wyświetleniu nazwy przechowywanej sekwencji użytkownikowi, proces 200 przechodzi do stanu decyzji 218, w którym ustala się czy w bazie danych jest więcej sekwencji. Jeśli w bazie danych nie ma więcej sekwencji, wtedy proces 200 kończy się w stanie końcowym 220. Jednakże, jeżeli w bazie danych jest więcej sekwencji, wtedy proces 200 przechodzi do stanu 224 w którym wskaźnik zostanie przeniesiony do kolejnej sekwencji w bazie danych, żeby można było wykonać porównanie do nowej sekwencji. W ten sposób nowa sekwencja jest dopasowywana i porównywana z każdą sekwencją w bazie danych. [0199] Należy zauważyć, że jeśli ustali się w stanie decyzji 212, że sekwencje nie były homologiczne, wtedy proces 200 przejdzie niezwłocznie do stanu decyzji 218, w celu określenia, czy są dostępne jakiekolwiek inne sekwencje w bazie danych do porównań. Stosownie do tego, jeden aspekt według ujawnienia to system komputerowy zawierający procesor, urządzenie do przechowywania danych mające zapisaną w swojej pamięci sekwencję kwasu nukleinowego według wynalazku i sekwencję porównawczą, do przeprowadzenia porównania. Sekwencja porównawcza może wskazywać poziom homologii pomiędzy porównywanymi sekwencjami lub identyfikować motywy strukturalne, lub może identyfikować motywy strukturalne w sekwencjach, które są porównywane do tych kodów kwasu nukleinowego i kodów polipeptydu. [0200] Figura 3 to schemat przepływowy ilustrujący jeden przykład wykonania procesu 250 w komputerze, w celu określenia czy dwie sekwencje są homologiczne. Proces 250 rozpoczyna się w punkcie startu 252, a następnie przechodzi do stanu 254, w którym pierwsza sekwencja do porównań jest przechowywana w pamięci. Druga sekwencja do porównań jest następnie przechowywana w pamięci w stanie 256. Proces 250 przechodzi następnie do stanu 260, w którym odczytuje się pierwszy znak w pierwszej sekwencji, a następnie do stanu 262, w którym odczytuje się pierwszy znak drugiej sekwencji. Należy rozumieć, że jeśli sekwencja oznacza sekwencję nukleotydową, wtedy znak będzie normalnie oznaczać A, T, C, G lub U. Jeśli sekwencja oznacza sekwencję białkową, wtedy może on oznaczać jednoliterowy kod aminokwasowy, tak żeby można było łatwo porównywać pierwszą i drugą sekwencję. Następnie ustala się, w stanie decyzji 264 czy dwa znaki są takie same. Jeżeli są one takie same, wtedy proces 250 przechodzi do stanu 268, w którym odczytuje się kolejne znaki w pierwszej i drugiej sekwencji. Następnie ustala się czy kolejne znaki są takie same. Jeżeli są, wtedy proces 250 pozostaje w tej pętli do momentu, aż dwa znaki nie będą takie same. Jeśli ustali się, że kolejne dwa znaki nie są takie same, proces 250 przechodzi do stanu decyzji 274, aby ustalić czy jest więcej znaków w którejkolwiek z sekwencji do odczytania. Jeżeli nie ma więcej znaków do odczytania, wtedy proces 250 przechodzi do stanu 276, w którym poziom homologii pomiędzy pierwszą i drugą sekwencją jest wyświetlany użytkownikowi. Poziom homologii ustala się przez obliczanie proporcji znaków pomiędzy sekwencjami, które były takie same na całkowitą liczbę znaków w pierwszej sekwencji. Zatem jeśli każdy znak w pierwszych 100 znakach sekwencji nukleotydowej został dopasowany do każdego znaku w drugiej sekwencji, poziom homologii będzie wynosił 100%. -60- [0201] Alternatywnie, program komputerowy może porównać sekwencję referencyjną do sekwencji według wynalazku, aby ustalić, czy sekwencje różnią się przy jednej lub więcej pozycji. Program może zapisywać długość i identyczność ulegających insercji, delecji lub substytucji nukleotydów lub reszt aminokwasowych w odniesieniu do sekwencji referencyjnej lub według wynalazku. Program komputerowy może oznaczać program, który określa, czy sekwencja referencyjna zawiera polimorfizm pojedynczego nukleotydu (SNP) w odniesieniu do sekwencji według wynalazku, lub czy sekwencja według wynalazku zawiera SNP znanej sekwencji. Zatem, w pewnych aspektach, program komputerowy oznacza program który identyfikuje SNP. Sposób może podlegać implementacji przez systemy komputerowe opisane powyżej i sposób zilustrowany na figurze 3. Sposób może polegać na odczytywaniu sekwencji według wynalazku i sekwencji referencyjnych przez zastosowanie programu komputerowego i identyfikowanie różnic za pomocą programu komputerowego. [0202] W innych aspektach, system na bazie komputera zawiera identyfikator do identyfikowania cech w obrębie kwasu nukleinowego lub polipeptydu według wynalazku. ?Identyfikator? dotyczy jednego lub więcej programów, które identyfikują pewne cechy w obrębie sekwencji kwasu nukleinowego. Na przykład, identyfikator może zawierać program, który identyfikuje otwartą ramkę odczytu (ORF) w sekwencji kwasu nukleinowego. Figura 4 to schemat przepływowy ilustrujący jeden aspekt procesu identyfikatora 300 do wykrywania obecności cechy w sekwencji. Proces 300 rozpoczyna się w punkcie startu 302, a następnie przechodzi do stanu 304, w którym pierwsza sekwencja do sprawdzenia pod kątem cech jest przechowywana w pamięci 115 w systemie komputerowym 100. Proces 300 następnie przechodzi do stanu 306, w którym otwierana jest baza danych cech sekwencji. Taka baza danych będzie zawierać wykaz atrybutów każdej cechy, wraz z nazwą cechy. Na przykład, nazwa cechy może brzmieć ?kodon inicjujący? a atrybutem będzie ?ATG?. Kolejnym przykładem będzie nazwa cechy ?kaseta TAATAA?, a atrybutem cechy będzie ?TAATAA?. Przykład takiej bazy danych wykonała grupa Genetics Computer Group z University of Wisconsin. Alternatywnie, cechy mogą oznaczać strukturalne motywy polipeptydu takie, jak helisy alfa, arkusze beta lub funkcjonalne motywy polipeptydu takie, jak enzymatyczne miejsca aktywne, motywy helisa-skręt-helisa lub inne motywy znane znawcy. Po otwarciu bazy danych cech w stanie 306, proces 300 przechodzi do stanu 308 w którym odczytywana jest pierwsza cecha z bazy danych. Następnie wykonuje się porównanie atrybutu pierwszej cechy z pierwszą sekwencją, w stanie 310. Następnie ustala się w stanie decyzji 316, czy znaleziono atrybut cechy w pierwszej sekwencji. Jeśli znaleziono atrybut, wtedy proces 300 przechodzi do stanu 318, w którym nazwa znalezionej cechy jest wyświetlana użytkownikowi. Proces 300 przechodzi następnie do stanu decyzji 320 w którym ustala się, czy w bazie danych występuje więcej cech. Jeżeli nie ma więcej cech, wtedy proces 300 kończy się, w stanie końcowym 324. Jednakże, jeżeli w bazie danych jest więcej cech, wtedy proces 300 odczytuje kolejną cechę sekwencji, w stanie 326 i wykonuje pętlę powrotną do stanu 310, w którym porównuje się atrybut kolejnej cechy z pierwszą sekwencją. Jeżeli nie znaleziono atrybutu cechy w pierwszej sekwencji w stanie decyzji 316, proces 300 przechodzi bezpośrednio do stanu decyzji 320, w celu określenia, czy w bazie danych jest więcej -61- jakichkolwiek cech. Zatem, w jednym aspekcie, ujawnienie zapewnia program komputerowy, który identyfikuje otwarte ramki odczytu (ORF). [0203] Sekwencja polipeptydu lub sekwencja kwasu nukleinowego według wynalazku mogą być przechowywane i poddawane operacjom w szeregu programów do przetwarzania danych, w szeregu formatów. Na przykład, sekwencję można przechowywać jako tekst w pliku do przetwarzania tekstu, takim jak Microsoft WORD lub WORDPERFECT lub jako plik ASCII w szeregu programów baz danych znanych znawcy takich, jak DB2, SYBASE lub ORACLE. Dodatkowo, można stosować wiele programów komputerowych i baz danych jako algorytm do porównywania sekwencji, identyfikatory lub źródła referencyjnych sekwencji nukleotydowych lub sekwencji polipeptydów do porównań do sekwencji kwasu nukleinowego według wynalazku. Programy i bazy danych stosowane do praktykowania wynalazku obejmują, w sposób nieograniczający: MacPattern (EMBL), DiscoveryBase (Molecular Applications Group), GeneMine (Molecular Applications Group), Look (Molecular Applications Group), MacLook (Molecular Applications Group), BLAST i BLAST2 (NCBI), BLASTN i BLASTX (Altschul i wsp., J. Mol. Biol. 215: 403, 1990), FASTA (Pearson i Lipman, Proc. Natl. Acad. Sci. USA, 85: 2444, 1988), FASTDB (Brutlag i wsp. Comp. App. Biosci. 6:237-245, 1990), Catalyst (Molecular Simulations Inc.), Catalyst/SHAPE (Molecular Simulations Inc.), Cerius2.DBAccess (Molecular Simulations Inc.), HypoGen (Molecular Simulations Inc.), Insight II, (Molecular Simulations Inc.), Discover (Molecular Simulations Inc.), CHARMm (Molecular Simulations Inc.), Felix (Molecular Simulations Inc.), DelPhi, (Molecular Simulations Inc.), QuanteMM, (Molecular Simulations Inc.), Homology (Molecular Simulations Inc.), Modeler (Molecular Simulations Inc.), ISIS (Molecular Simulations Inc.), Quanta/Protein Design (Molecular Simulations Inc.), WebLab (Molecular Simulations Inc.), WebLab Diversity Explorer (Molecular Simulations Inc.), Gene Explorer (Molecular Simulations Inc.), SeqFold (Molecular Simulations Inc.), bazę danych MDL Available Chemicals Directory, bazę danych MDL Drug Data Report, całościową bazę danych Medicinal Chemistry, bazę danych Derwent's World Drug Index, bazę danych BioByteMasterFile, bazę danych Genbank i bazę danych Genseqn. Wiele innych programów i baz danych będzie oczywiste dla znawcy, biorąc pod uwagę niniejsze ujawnienie. [0204] Motywy, który można wykrywać przy użyciu powyższych programów obejmują sekwencje kodujące zamki leucynowe, motywy helisa-skręt-helisa, miejsca glikozylacji, miejsca ubikwitynacji, helisy alfa i arkusze beta, sekwencje sygnałowe kodujące peptydy sygnałowe, które kierują wydzielaniem kodowanych białek, sekwencje biorące udział w regulacji transkrypcji takie, jak kasety homeobox, ciągi reszt kwasowych, enzymatyczne miejsca aktywne, miejsca wiązania substratu i enzymatyczne miejsca cięcia. Hybrydyzacja kwasów nukleinowych [0205] Ujawnienie dostarcza wyizolowane lub rekombinowane kwasy nukleinowe, które hybrydyzują w rygorystycznych warunkach do przykładowej sekwencji według ujawnienia, np. sekwencji jak podano w SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID -62- NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, SEQ ID NO:71, SEQ ID NO:73, SEQ ID NO:75, SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:91, SEQ ID NO:93, SEQ ID NO:95, SEQ ID NO:97, SEQ ID NO:99, SEQ ID NO:101, SEQ ID NO:103, SEQ ID NO:105, SEQ ID NO:107, SEQ ID NO:109 SEQ ID NO:111, SEQ ID NO:113, SEQ ID NO:115, SEQ ID NO:117, SEQ ID NO:119, SEQ ID NO:121, SEQ ID NO:123, SEQ ID NO:125, SEQ ID NO:127, SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ ID NO:135, SEQ ID NO:137, SEQ ID NO:139, SEQ ID NO:141, SEQ ID NO:143, SEQ ID NO:145, SEQ ID NO:147, SEQ ID NO:149, SEQ ID NO:151, SEQ ID NO:153, SEQ ID NO:155, SEQ ID NO:157, SEQ ID NO:159, SEQ ID NO:161, SEQ ID NO:163, SEQ ID NO:165, SEQ ID NO:167, SEQ ID NO:169, SEQ ID NO:171 lub SEQ ID NO:173, lub kwas nukleinowy, który koduje polipeptyd zawierający sekwencję jak podano w SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:74, SEQ ID NO:76, SEQ ID NO:78, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, SEQ ID NO:92, SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:102, SEQ ID NO:104, SEQ ID NO:106, SEQ ID NO:108 SEQ ID NO:110, SEQ ID NO:112, SEQ ID NO:114, SEQ ID NO:116, SEQ ID NO:118, SEQ ID NO:120, SEQ ID NO:122, SEQ ID NO:124, SEQ ID NO:126, SEQ ID NO:128, SEQ ID NO:130, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:136, SEQ ID NO:38; SEQ ID NO:140; SEQ ID NO:142; SEQ ID NO:144; NO:146, SEQ ID NO:148, SEQ ID NO:150, SEQ ID NO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ ID NO:168, SEQ ID NO:170, SEQ ID NO:172, lub SEQ ID NO:174. Rygorystyczne warunki mogą oznaczać wysoce rygorystyczne warunki, średnio rygorystyczne warunki, mało rygorystyczne warunki, w tym warunki o wysokiej i obniżonej rygorystyczności, jak tu opisane. W alternatywnych przykładach wykonania, kwasy nukleinowe według ujawnienia, jak zdefiniowano poprzez ich zdolność do hybrydyzowania w rygorystycznych warunkach, mogą mieć od około pięciu reszt do pełnej długości cząsteczki, np. przykładowego kwasu nukleinowego według wynalazku. Na przykład, mogą one mieć co najmniej 5, 10, 15, 20, 25, 30, 35, 40, 50, 55, 60, 65, 70, 75, 80, 90, 100, 150, 200, 250, 300, 350, 400 lub więcej reszt długości. Ujęte są również kwasy nukleinowe krótsze niż te o pełnej długości. Te kwasy nukleinowe są użyteczne jako, np. sondy do hybrydyzacji, sondy do znakowania, oligonukleotydowe sondy PCR, iRNA (pojedynczo- lub dwuniciowe), antysens -63- lub sekwencje kodujące peptydy wiążące przeciwciało (epitopy), motywy, miejsca aktywne, domeny wiążące, domeny regulatorowe i podobne. [0206] W jednym aspekcie, kwasy nukleinowe według ujawnienia są definiowane przez swoją zdolność do hybrydyzowania w warunkach o wysokiej rygorystyczności, z około 50% formamidem w około 37°C do 42°C. W jednym aspekcie, kwasy nukleinowe według ujawnienia są definiowane przez swoją zdolność do hybrydyzowania w warunkach o obniżonej rygorystyczności, w około 35% do 25% formamidzie, w około 30°C do 35°C. Alternatywnie, kwasy nukleinowe według ujawnienia są definiowane przez swoją zdolność do hybrydyzowania w warunkach o wysokiej rygorystyczności w 42°C, w 50% formamidzie, 5X SSPE, 0,3% SDS, i z powtarzalnymi sekwencjami blokującymi kwas nukleinowy takimi, jak cot-1 lub DNA spermy łososia (np. 200 u/ml pociętego i denaturowanego DNA spermy łososia). W jednym aspekcie, kwasy nukleinowe według ujawnienia są definiowane przez swoją zdolność do hybrydyzowania w warunkach o obniżonej rygorystyczności w 35% formamidzie w obniżonej temperaturze 35°C. [0207] Po hybrydyzacji filtr można odmywać 6X SSC, 0,5% SDS w 50°C. Te warunki są uznawane za warunki ?umiarkowane? powyżej 25% formamidu i ?niskie? poniżej 25% formamidu. Specyficzny przykład ?umiarkowanych? warunków hybrydyzacji występuje, gdy powyższą hybrydyzację prowadzi się w 30% formamidzie. Specyficzny przykład warunków hybrydyzacji ?o niskiej rygorystyczności? występuje, gdy powyższą hybrydyzację prowadzi się w 10% formamidzie. [0208] Zakres temperatur odpowiadających określonemu poziomowi rygorystyczności może być dalej zawężony przez wyliczenie stosunku puryn do pirymidyn przedmiotowego kwasu nukleinowego i stosownie do tego, wyregulowanie temperatury. Kwasy nukleinowe według ujawnienia są również definiowane przez swoją zdolność do hybrydyzowania w warunkach o wysokiej, średniej i niskiej rygorystyczności, jak podano w Ausubel i Sambrook. Można stosować wariacje powyższych zakresów i warunków przy praktykowaniu ujawnienia, co jest dobrze znane ze stanu techniki. Warunki hybrydyzacji są omówione dokładniej poniżej. Sondy oligonukleotydowe i sposoby ich zastosowania [0209] Ujawnienie zapewnia również sondy kwasu nukleinowego do identyfikacji kwasów nukleinowych kodujących polipeptyd mający aktywność fosfolipazy. W jednym aspekcie, sonda zawiera co najmniej 10 kolejnych zasad sekwencji jak podano w SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, SEQ ID NO:71, SEQ ID NO:73, SEQ ID NO:75, SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:91, SEQ ID NO:93, SEQ ID NO:95, SEQ ID NO:97, SEQ ID NO:99, SEQ ID NO:101, SEQ ID -64- NO:103, SEQ ID NO:105, SEQ ID NO:107 SEQ ID NO:109 SEQ ID NO:111, SEQ ID NO:113, SEQ ID NO:115, SEQ ID NO:117, SEQ ID NO:119, SEQ ID NO:121, SEQ ID NO:123, SEQ ID NO:125, SEQ ID NO:127, SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ ID NO:135, SEQ ID NO:137, SEQ ID NO:139, SEQ ID NO:141, SEQ ID NO:143, SEQ ID NO:145, SEQ ID NO:147, SEQ ID NO:149, SEQ ID NO:151, SEQ ID NO:153, SEQ ID NO:155, SEQ ID NO:157, SEQ ID NO:159, SEQ ID NO:161, SEQ ID NO:163, SEQ ID NO:165, SEQ ID NO:167, SEQ ID NO:169, SEQ ID NO:171 lub SEQ ID NO:173. Alternatywnie, sonda według ujawnienia może mieć co najmniej około 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 50, 55, 60, 65, 70, 75, 80, 90, 100, lub 150, lub więcej, lub około 10 do 50, około 20 do 60 około 30 do 70, kolejnych zasad sekwencji jak podano w sekwencji według ujawnienia. Sondy identyfikują kwas nukleinowy przez wiązanie lub hybrydyzację. Sondy można stosować w macierzach według ujawnienia, patrz dyskusja poniżej, w tym, np. macierzach kapilarnych. Sondy według ujawnienia można także stosować do izolowania innych kwasów nukleinowych lub polipeptydów. [0210] Sondy według ujawnienia mogą być stosowane do określenia, czy próbka biologiczna, jak próbka gleby, zawiera organizm o sekwencji kwasu nukleinowego według wynalazku lub organizm, z którego otrzymano kwas nukleinowy. W takich procedurach, otrzymuje się próbkę biologiczną ewentualnie mającą organizm, z którego wyizolowano kwas nukleinowy, i z próbki otrzymuje się kwasy nukleinowe. Kwasy nukleinowe kontaktuje się z sondą w warunkach, które umożliwiają specyficzną hybrydyzację sondy do komplementarnych sekwencji obecnych w próbce. Jeżeli jest to konieczne, warunki, które umożliwiają sondzie specyficzną hybrydyzację z komplementarnymi sekwencjami można określić umieszczając sondę w kontakcie z komplementarnymi sekwencjami z próbkami, o których wiadomo, że zawierają sekwencję komplementarną jak również sekwencjami kontrolnymi, które nie zawierają sekwencji komplementarnej. Warunki hybrydyzacji takie, jak stężenie soli w buforze do hybrydyzacji, stężenie formamidu w buforze do hybrydyzacji, czy temperatura hybrydyzacji, mogą się zmieniać w celu identyfikacji warunków, które umożliwiają hybrydyzację sondy specyficznie z komplementarnymi kwasami nukleinowymi (patrz dyskusja na temat konkretnych warunków hybrydyzacji). [0211] Jeśli próbka zawiera organizm, z którego wyizolowano kwas nukleinowy, wówczas wykrywa się specyficzną hybrydyzację sondy. Hybrydyzację można wykrywać przez znakowanie sondy środkiem wykrywalnym takim, jak radioaktywny izotop, barwnik fluorescencyjny lub enzym zdolny do katalizowania tworzenia się wykrywalnych produktów. Wiele metod z wykorzystaniem znakowanych sond do wykrywania obecności komplementarnych kwasów nukleinowych w próbce jest znanych znawcom w tej dziedzinie. Należą do nich Southern Bloty, Northern Bloty, procedury do hybrydyzacji kolonii i dot bloty. Protokoły dla każdej z tych procedur są zamieszczone w Ausubel i Sambrook. [0212] Alternatywnie, więcej niż jedną sondę (co najmniej jedna z nich jest zdolna do specyficznego hybrydyzowania z komplementarnymi sekwencjami, które są obecne w próbce kwasu nukleinowego), można stosować w reakcji amplifikacji w celu określenia, czy próbka -65- zawiera organizm, zawierający sekwencję kwasu nukleinowego według wynalazku (np. organizm, z którego wyizolowano kwas nukleinowy). W jednym aspekcie, sondy zawierają oligonukleotydy. W jednym aspekcie, reakcja amplifikacji może obejmować reakcję PCR. Protokoły PCR są opisane w Ausubel i Sambrook (zobacz dyskusję na temat reakcji amplifikacji). W takich procedurach, kwasy nukleinowe w próbce kontaktuje się z sondami, przeprowadza się reakcję amplifikacji i wykrywa dowolny otrzymany produkt amplifikacji. Produkt amplifikacji można wykryć przeprowadzając elektroforezę na żelu i barwienie produktów reakcji żelu interkalatorem takim, jak bromek etydyny. Alternatywnie, jedną lub więcej sond można znakować izotopem radioaktywnym i obecność radioaktywnego produktu amplifikacji można wykryć za pomocą autoradiografii po elektroforezie żelowej. [0213] Sondy pochodzące z sekwencji w pobliżu końców 3' lub 5' sekwencji kwasu nukleinowego według wynalazku mogą być również stosowane w procedurach spaceru po chromosomie do identyfikacji klonów zawierających dodatkowe, na przykład, genomowe sekwencje. Takie metody pozwalają na izolację genów, które kodują białka będące przedmiotem zainteresowania z komórek gospodarza. [0214] Sekwencje kwasów nukleinowych według wynalazku można stosować jako sondy do identyfikacji i izolacji związanych kwasów nukleinowych. W niektórych aspektach, tak zidentyfikowane odpowiednie kwasy nukleinowe mogą być cDNA lub genomowymi DNA z organizmów, innych niż ten, z którego kwas nukleinowy według wynalazku został wyizolowany po raz pierwszy. W takich procedurach, próbkę kwasu nukleinowego kontaktuje się z sondą w warunkach, które umożliwiają hybrydyzację sondy specyficznie do sekwencji pokrewnych. Hybrydyzację sondy kwasów nukleinowych z pokrewnego organizmu następnie wykrywa się przy użyciu jednej z metod opisanych powyżej. [0215] W reakcji hybrydyzacji kwasów nukleinowych, warunki wykorzystywane w celu osiągnięcia określonego poziomu rygorystyczności będzie się różnił, w zależności od charakteru kwasów nukleinowych, które są hybrydyzowane. Na przykład, długość, stopień komplementarności, składu sekwencji nukleotydowej (np. zawartość GC v. AT), i rodzaj kwasu nukleinowego (np. RNA v. DNA) hybrydyzujących regionów kwasów nukleinowych można rozważyć podczas wyboru warunków hybrydyzacji. Dodatkowym czynnikiem jest to, czy jeden z kwasów nukleinowych jest unieruchomiony, na przykład na sączku. Hybrydyzacja może być przeprowadzana w warunkach o niskiej rygorystyczności, umiarkowanej rygorystyczności i wysokiej rygorystyczności. Jako przykład hybrydyzacji kwasu nukleinowego, membranę polimerową zawierającą unieruchomione denaturowane kwasy nukleinowe najpierw prehybrydyzuje się przez 30 minut w temperaturze 45°C w roztworze składającym się z 0.9 M NaCl, 50 mM NaH2PO4, pH 7.0, 5,0 mM Na2EDTA, 0,5% SDS, 10X Denhardta, i 0,5 mg/ml kwasu poliryboadenylowego. Następnie dodaje się do roztworu około 2 X 107 cpm (specyficzna aktywność 4-9 X 108 cpm/ug) sondy oligonukleotydowej końcowo wyznakowanej 32P. Po 12-16 godzinach inkubacji, membranę przemywa się przez 30 minut w temperaturze pokojowej (RT) w 1X SET (150 mM NaCl, 20 mM chlorowodorek Tris, pH 7.8, 1 mM Na2EDTA) zawierającym 0,5% SDS, a następnie przemywa w 30 minut w świeżej 1X SET w Tm-10°C dla sondy oligonukleotydowej. -66- Membranę następnie poddaje się działaniu automatycznego filmu radiograficznego do wykrywania sygnałów hybrydyzacji. [0216] Zmieniając rygorystyczność warunków do hybrydyzacji stosowanych do identyfikacji kwasów nukleinowych takich, jak cDNA lub genomowe DNA, które hybrydyzują z wykrywalną sondą, można zidentyfikować i wyizolować kwasy nukleinowe o różnych poziomach homologii do sondy. Rygorystyczność można zmieniać prowadząc hybrydyzację w różnych temperaturach poniżej temperatury topnienia sondy. Temperatura topnienia, Tm, jest temperaturą (przy określonej sile jonowej i pH), w której 50% sekwencji docelowej hybrydyzuje z całkowicie komplementarną sondą. Bardzo rygorystyczne warunki wybiera się jako równe lub około 5°C niższe niż Tm dla danej sondy. Temperaturę topnienia sondy można obliczyć za pomocą następujących przykładowych wzorów. Dla sond od 14 do 70 nukleotydów długości temperaturę topnienia (Tm) oblicza się za pomocą wzoru: Tm=81,5+16,6(log [Na+])+0,41(ułamek G+C)-(600/N), przy czym N to długość sondy. Jeśli hybrydyzację przeprowadza się w roztworze zawierającym formamid, temperatura topnienia może być obliczona za pomocą równania: Tm=81,5+16,6(log [Na+])+0.41(ułamek G+C)(0,63% formamid)-(600/N), przy czym N to długość sondy. Prehybrydyzacja może być przeprowadzana w 6X SSC, 5X odczynnik Denhardta, 0,5% SDS, 100?g zdenaturowanego rozdrobnionego DNA ze spermy łososia lub 6X SSC, 5X odczynnik Denhardta, 0,5% SDS, 100?g zdenaturowanego rozdrobnionego DNA ze spermy łososia, 50% formamid. Formuły dla SSC i Denhardta i innych roztworów są wymienione, na przykład w Sambrook. [0217] Hybrydyzację przeprowadza się przez dodanie sondy wykrywalnej do roztworów do prehybrydyzacji wymienionych powyżej. Gdy sonda zawiera dwuniciowy DNA, jest on denaturowany przed dodaniem do roztworu hybrydyzacyjnego. Sączek kontaktuje się z roztworem hybrydyzacyjnym przez wystarczający okres czasu, aby pozwolić na hybrydyzację sondy do cDNA lub genomowych DNA zawierających sekwencje do nich komplementarne lub homologiczne do nich. Dla sond o ponad 200 nukleotydów długości, hybrydyzacja może być przeprowadzona w 15-25°C poniżej Tm. W przypadku krótszych sond takich, jak sondy oligonukleotydowe, hybrydyzację można prowadzić w 5-10°C poniżej Tm. W jednym aspekcie, hybrydyzacje w 6X SSC przeprowadza się w temperaturze około 68°C. W jednym aspekcie, hybrydyzacje w roztworach zawierających 50% formamid przeprowadza się w temperaturze około 42°C. Wszystkie powyższe hybrydyzacje byłyby uważane za w warunkach wysokiej rygorystyczności. [0218] Po hybrydyzacji, sączek przemywa się w celu usunięcia niespecyficznie związanej sondy wykrywalnej. Rygorystyczność stosowana do przemywania sączka może być różna w zależności od charakteru hybrydyzowanych kwasów nukleinowych, długości hybrydyzowanych kwasów nukleinowych, stopnia komplementarności, składu sekwencji nukleotydowej (np. zawartość GC v. AT), i typu kwasu nukleinowego (np. RNA v. DNA). Przykłady stopniowo bardziej rygorystycznych warunków przemywania są następujące: 2X SSC, 0,1% SDS w temperaturze pokojowej przez 15 minut (niska rygorystyczność); 0,1X SSC, 0,5% SDS w temperaturze pokojowej przez 30 minut do 1 godziny (umiarkowana rygorystyczność); 0,1X SSC, 0,5% SDS przez 15 do 30 minut w temperaturze pomiędzy -67- temperaturą hybrydyzacji i 68°C (wysoka rygorystyczność); i 0,15M NaCl przez 15 minut w 72°C (bardzo wysoka rygorystyczność). Końcowe przemywanie o niskiej rygorystyczności można prowadzić w 0,1X SSC w temperaturze pokojowej. Powyższe przykłady stanowią jedynie ilustrację jednego zestawu warunków, które mogą być stosowane do praktykowania wynalazku, np. do przemywania sączków. Znawca w dziedzinie będzie wiedział, że istnieje wiele receptur przemywań o różnej rygorystyczności, z których wszystkie można stosować do praktykowania ujawnienia. [0219] Kwasy nukleinowe, które zhybrydyzowały z sondą, można zidentyfikować poprzez autoradiografię lub innymi konwencjonalnymi technikami. Powyższa procedura może być modyfikowana w celu identyfikacji kwasów nukleinowych o zmniejszającym się poziomie homologii do sekwencji sondy. Na przykład, w celu otrzymania kwasów nukleinowych o zmniejszającej się homologii z wykrywalną sondą, można stosować mniej rygorystyczne warunki. Na przykład, temperatura hybrydyzacji, może być zmniejszona w odstępach 5°C od 68°C do 42°C w buforze hybrydyzacyjnym o stężeniu Na+ około 1M. Po hybrydyzacji, sączek można przemyć 2X SSC, 0,5% SDS w temperaturze hybrydyzacji. Warunki te są uważane za warunki ?umiarkowane? powyżej 50°C i warunki ?niskie? poniżej 50°C. Przykładem ?umiarkowanych? warunków hybrydyzacji jest ten, gdy powyższa hybrydyzacja jest przeprowadzana przy 55°C. Przykładem warunków hybrydyzacji ?niskiej rygorystyczności? jest ten, gdy powyższa hybrydyzacja jest przeprowadzana przy 45°C. [0220] Alternatywnie, hybrydyzację można przeprowadzić w buforach takich, jak 6X SSC, zawierających formamid w temperaturze 42°C. W tym przypadku, stężenie formamidu w buforze do hybrydyzacji można zmniejszać w odstępach co 5% od 50% do 0% dla zidentyfikowania klonów o zmniejszających się poziom homologii do sondy. Po hybrydyzacji, sączek można przemyć 6X SSC, 0,5% SDS w 50°C. Warunki te są uważane za warunki ?umiarkowane? powyżej 25% formamidu i warunki ?niskie? poniżej 25% formamidu. Konkretnym przykładem ?umiarkowanych? warunków hybrydyzacji jest ten, gdy powyższa hybrydyzacja jest przeprowadzana w 30% formamidzie. Konkretnym przykładem hybrydyzacji w warunkach ?niskiej rygorystyczności? jest ten, gdy powyższa hybrydyzacja jest przeprowadzana w 10% formamidzie. [0221] Te sondy i sposoby według ujawnienia mogą być stosowane do izolacji kwasów nukleinowych, mających sekwencję z co najmniej 99%, co najmniej 98%, co najmniej 97%, co najmniej 96%, co najmniej 95%, co najmniej 90%, co najmniej 85%, co najmniej 80%, co najmniej 75%, co najmniej 70%, co najmniej 65%, co najmniej 60%, co najmniej 55%, lub co najmniej 50% homologii do sekwencji kwasu nukleinowego według wynalazku zawierającej co najmniej 10, 15, 20, 25, 30, 35, 40, 50, 75, 100, 150, 200, 250, 300, 350, 400, lub 500 jego kolejnych zasad, oraz sekwencji do nich komplementarnych. Homologię można być zmierzyć za pomocą algorytmu dopasowywania, co zostało tu opisane. Na przykład homologiczne polinukleotydy mogą mieć sekwencję kodującą, która jest naturalnie występującym wariantem allelicznym jednej z opisanych tu sekwencji kodujących. Takie warianty alleliczne mogą mieć substytucję, delecję lub addycję jednego lub więcej nukleotydów w stosunku do kwasu nukleinowego według wynalazku. -68- [0222] Dodatkowo, sondy i sposoby według ujawnienia mogą być stosowane do izolacji kwasów nukleinowych, które kodują polipeptydy mające co najmniej około 99%, co najmniej 95%, co najmniej 90%, co najmniej 85%, co najmniej 80%, co najmniej 75%, co najmniej 70%, co najmniej 65%, co najmniej 60%, co najmniej 55%, lub co najmniej 50% identyczność sekwencji (homologii) do polipeptydu według ujawnienia zawierającego co najmniej 5, 10, 15, 20, 25, 30, 35, 40, 50, 75, 100, lub 150 jego kolejnych aminokwasów, jak określono za pomocą algorytmu do dopasowania sekwencji (np. jak algorytm FASTA wersja 3.0t78 z domyślnymi parametrami lub program BLAST 2.2.2 z przykładowymi ustawienia, które zostały tu wymienione). Hamowanie Ekspresji Fosfolipaz [0223] Wynalazek zapewnia dodatkowo kwasy nukleinowe komplementarne do (np. antysensowne sekwencje do) kwasów nukleinowych według wynalazku, np. kwasów nukleinowych kodujących fosfolipazę. Antysensowne sekwencje są zdolne do hamowania transportu, splicingu lub transkrypcji kodujących fosfolipazę genów. Hamowanie może być dokonane poprzez ukierunkowanie genomowego DNA lub RNA. Transkrypcja lub funkcja docelowego kwasu nukleinowego może być hamowana na przykład przez hybrydyzację i/lub rozszczepianie. Jeden szczególnie użyteczny dostarczony zestaw inhibitorów według niniejszego ujawnienia obejmuje oligonukleotydy, które są zdolne do wiązania zarówno genu lub informacji enzymu fosfolipazy, w każdym przypadku zapobiegając lub hamując wytwarzanie lub funkcję enzymu fosfolipazy. Asocjacja może odbywać się przez hybrydyzację specyficzną dla sekwencji. Inną użyteczną klasę inhibitorów obejmują oligonukleotydy, które powodują inaktywację lub odszczepienie informacji enzymu fosfolipazy. Oligonukleotyd może mieć aktywność enzymatyczną, która powoduje takie rozszczepienie, jak rybozymy. Oligonukleotyd może być zmodyfikowany chemicznie lub skoniugowany z enzymem lub kompozycją zdolną do cięcia komplementarnego kwasu nukleinowy. Można przeszukać pulę wielu takich oligonukleotydów pod kątem tych pożądanej aktywności. [0224] Hamowanie ekspresji fosfolipazy może mieć wiele różnych zastosowań przemysłowych. Na przykład, hamowanie ekspresji fosfolipazy może zmniejszyć lub zapobiec psuciu. Psucie może wystąpić, gdy lipidy lub polipeptydy, np. lipidy strukturalne lub polipeptydy są enzymatycznie degradowane. Może to prowadzić do pogorszenia stanu, lub gnicia, owoców i warzyw. W jednym aspekcie, zastosowanie kompozycji według ujawnienia które hamują ekspresję i/lub aktywność fosfolipazy, np. przeciwciała, antysensowne oligonukleotydy, rybozymy i RNAi, stosuje się do spowalniania lub zapobiegania psuciu. Zatem, w jednym aspekcie, ujawnienie zapewnia sposoby i kompozycje do zastosowanie na roślinach lub produktach roślinnych (np. owoce, nasiona, korzenie, liście, itp.) przeciwciał, antysensownych oligonukleotydów, rybozymów i RNAi według ujawnienia do spowolnienia lub zapobiegania psuciu. Kompozycje te mogą być również eksprymowane przez rośliny (np. roślinę transgeniczną) lub inny organizm (np. bakterię lub inny mikroorganizm transformowany genem fosfolipazy według wynalazku). -69- [0225] Kompozycje według ujawnienia do hamowania ekspresji fosfolipazy (np. antysens, iRNA, rybozymy, przeciwciała) mogą być stosowane jako kompozycje farmaceutyczne. Antysensowne Oligonukleotydy [0226] Ujawnienie zapewnia antysensowne oligonukleotydy zdolne do wiązania informacji fosfolipazy, które mogą hamować aktywność fosfolipazy przez celowanie w mRNA. Strategie do projektowania antysensownych oligonukleotydów są dobrze opisane w literaturze naukowej i patentowej i znawca może zaprojektować takie oligonukleotydy fosfolipazy przy użyciu nowych odczynników według ujawnienia. Na przykład protokoły spaceru po genie/ mapowania RNA do przesiewania dla wydajnych antysensownych oligonukleotydów są dobrze znane w tej dziedzinie, patrz, np. Ho (2000) Methods Enzymol. 314:168-183, opisujących oznaczenie do mapowania RNA, które opiera się na standardowych technikach molekularnych, dla zapewnienia łatwego i miarodajnego sposobu do selekcji silnych sekwencji antysensownych. Patrz również Smith (2000) Eur. J. Pharm. Sci. 11:191-198. [0227] Naturalnie występujące kwasy nukleinowe są używane jako antysensowne oligonukleotydy. Antysensowne oligonukleotydy mogą być dowolnej długości; na przykład, w alternatywnych aspektach, antysensowne oligonukleotydy mają między około 5 do 100, około 10 do 80, około 15 do 60, około 18 do 40. Optymalną długość można określić na podstawie rutynowych badań przesiewowych. Antysensowne oligonukleotydy mogą być obecne w dowolnym stężeniu. Optymalne stężenie można określić na podstawie rutynowych badań przesiewowych. Znane są różnorodne syntetyczne, niewystępujące w przyrodzie analogi nukleotydów i kwasów nukleinowych, które mogą rozwiązać ten potencjalny problem. Na przykład, można wykorzystać peptydowe kwasy nukleinowe (PNA) zawierające niejonowe szkielety, jak jednostki N-(2-aminoetylo)glicyny. Antysensowne oligonukleotydy mające wiązania fosforotionianowe mogą być również stosowane tak, jak opisano w WO 97/03211; WO 96/39154; Mata (1997) Toxicol Appl Pharmacol 144:189-197; Antisense Therapeutics, ed. Agrawal (Humana Press, Totowa, N.J., 1996). Antysensowne oligonukleotydy mające syntetyczne analogi szkieletu DNA zapewnione przez to ujawnienie mogą również zawierać fosforo-ditionian, metylofosfonian, amidofosforan, fosfotriester alkilu, sulfaminian, 3'-tioacetal, metyleno(metyloimino), 3'-N-karbaminian, i morfolino karbaminianowe kwasy nukleinowe, jak opisano powyżej. [0228] Metodologię chemii kombinatorycznej można stosować do tworzenia ogromnej liczby oligonukleotydów, które można szybko przeszukiwać pod kątem specyficznych oligonukleotydów, które mają odpowiednie powinowactwo wiązania i specyfikę w kierunku każdego celu, jak sensowne i antysensowne sekwencje fosfolipaz według wynalazku (patrz, np. Gold (1995) J. ofBiol. Chem. 270:13581-13584). Inhibitorowe Rybozymy [0229] Ujawnienie zapewnia rybozymy zdolne do wiązania informacji fosfolipazy, które mogą hamować aktywność enzymu fosfolipazy przez celowanie w mRNA. Strategie do projektowania rybozymów i selekcji specyficznych dla fosfolipazy sekwencji antysensownych do nakierowywania są dobrze opisane w literaturze naukowej i patentowej i -70- znawca może zaprojektować takie rybozymy przy użyciu nowych odczynników według ujawnienia. Rybozymy działają poprzez wiązanie się z docelowym RNA przez część wiązania docelowego RNA rybozymu, który jest utrzymywany w pobliżu enzymatycznej części RNA, który przecina docelowy RNA. Tak więc, rybozym rozpoznaje i wiąże się do docelowego RNA przez komplementarne parowanie zasad, i po związaniu się z prawidłowym miejscem, działa enzymatycznie rozszczepiając i inaktywując docelowy RNA. Rozszczepienie docelowego RNA w taki sposób niszczy jego zdolność do bezpośredniej syntezy kodowanego białka, jeśli następuje rozszczepienie sekwencji kodującej. Po tym, jak rybozym związał się i rozszczepił swój cel RNA, jest uwalniany z tego RNA, a zatem może się wiązać i rozszczepiać nowe cele w sposób powtarzalny. [0230] W pewnych okolicznościach, enzymatyczna natura rybozymu może być korzystna w porównaniu z innymi technologiami takimi, jak technologia antysensowna (w której cząsteczka kwasu nukleinowego wiąże się tylko z docelowym kwasem nukleinowym, blokuje jego transkrypcję, translację lub w asocjację z inną cząsteczką), ponieważ skuteczne stężenie rybozymu potrzebne do uzyskania leczenia terapeutycznego może być niższe niż antysensownego oligonukleotydu. Ta potencjalna korzyść odzwierciedla zdolność rybozymu do działania enzymatycznego. Tak więc, pojedyncza cząsteczka rybozymu jest w stanie rozszczepiać wiele cząsteczek docelowego RNA. Ponadto, rybozym jest zwykle bardzo specyficznym inhibitorem, o specyficzności hamowania zależnej nie tylko od mechanizmu parowania zasad wiązania, ale również od mechanizmu, dzięki któremu cząsteczka hamuje ekspresję RNA, do którego się wiąże. Oznacza to, że hamowanie to jest spowodowane przez rozszczepienie docelowego RNA, a więc specyficzność zdefiniowana jako stosunek szybkości rozszczepiania docelowego RNA do szybkości odszczepiania nieukierunkowanego RNA. Ten mechanizm cięcia jest zależny od czynników dodatkowych do tych zaangażowanych w tworzenie par podstawowych. Tak więc, specyficzność działania rybozymu może być większa niż antysensownego oligonukleotydu wiążącego to samo miejsce RNA. [0231] Cząsteczka RNA rybozymu enzymatycznego może być utworzona w motywie głowy młotka, ale może być również utworzona w motywie spinki do włosów, wirusa zapalenia wątroby delta, motyw intronów grupy I lub RNA podobnego do RNazyP (w asocjacji z sekwencją prowadzącą RNA). Przykłady takich motywów głowy młotka są opisane przez Rossi (1992) Aids Research and Human Retroviruses 8:183; motywy spinki do włosów przez Hampel (1989) Biochemistry 28:4929, i Hampel (1990) Nuc. Acids Res. 18:299; motyw wirusa zapalenia wątroby delta przez Perrotta (1992) Biochemistry 31:16; motyw RNazyP przez Guerrier-Takada (1983) Cell 35:849; i intron grupy I przez Pat. US Nr 4,987,071 dla Cech. Przytaczane tych specyficznych motywów nie ma na celu ograniczania; znawcy w dziedzinie zauważą, że enzymatyczna cząsteczka RNA według tego ujawnienia ma specyficzne miejsce wiązania substratu komplementarne do jednego lub większej liczby regionów genu docelowego RNA i ma sekwencję nukleotydową w obrębie lub otoczeniu tego miejsca wiążącego substrat, które nadaje aktywność rozszczepiania RNA cząsteczce. Interferencja RNA (RNAi) -71- [0232] Ujawnienie zapewnia cząsteczkę inhibitorową wobec RNA, tzw. cząsteczkę ?RNAi?, zawierającą sekwencję fosfolipazy według wynalazku. Cząsteczka RNAi zawiera cząsteczkę dwuniciowego RNA (dsRNA). RNAi może hamować ekspresję genu fosfolipazy. W jednym aspekcie, RNAi ma około 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 lub więcej nukleotydów dupleksu długości. Choć ujawnienie jest nieograniczone żadnym konkretnym mechanizmem działania, RNAi może wejść do komórki, powodując degradację jednoniciowego RNA (ssRNA) podobnych lub identycznych sekwencji, w tym endogennych mRNA. Kiedy komórka jest wystawiona na dwuniciowy RNA (dsRNA), mRNA z genu homologicznego jest selektywnie degradowany przez proces zwany interferencją RNA (RNAi). Możliwym mechanizmem leżącym u podstaw RNAi jest łamanie dwuniciowego RNA (dsRNA) pasującego do konkretnej sekwencji genu na krótkie kawałki zwane krótkim zakłócającym RNA, które wywołują degradację mRNA, który pasuje do jego sekwencji. W jednym aspekcie, RNAi stosuje się w wyciszaniu genów terapeutycznych, patrz, np. Shuey (2002) Drug Discov. Today 7:1040-1046. Ujawnienie zapewnia sposoby selektywnego degradowania RNA stosując RNAi według ujawnienia. Sposób może być praktykowany in Vitro, ex vivo lub in vivo. Cząsteczki RNAi według ujawnienia można stosować do generowania mutacji z utratą funkcji w komórce narządzie lub zwierzęciu. Sposoby wytwarzania i stosowania cząsteczek RNAi do selektywnej degradacji RNA są dobrze znane ze stanu techniki, patrz np. Patent US Nr 6,506,559; US 6,511,824; US 6,515,109; US 6,489,127. Modyfikacja Kwasów Nukleinowych [0233] Ujawnienie zapewnia sposoby generowania wariantów kwasów nukleinowych według wynalazku, np. tych kodujących enzym fosfolipazy. W alternatywnym przykładzie wykonania ujawnienie zapewnia sposoby modyfikowania enzymu według ujawnienia, np. przez mutację jego sekwencji kodującej, sposobami losowymi lub stochastycznymi, bądź niestochastycznymi, lub za pomocą ?ukierunkowanej ewolucji? takimi, jak Gene Site Saturation Mutagenesis? (GSSM?), aby zmienić zakres aktywności enzymów w danym pH lub zakres optymalnej aktywności, zakres aktywności w danej temperaturze lub zakres optymalnej aktywności, specyfikę, aktywność (kinetykę); wykorzystywanie przez enzym glikozylacji, fosforylacji lub metali (np. Ca, Mg, Zn, Fe, Na), np. aby oddziaływać na stabilność w danym pH/temperaturze. Ujawnienie zapewnia sposoby modyfikowania enzymu według ujawnienia, np. przez mutację jego sekwencji kodującej, np. przez GSSM?, w celu podwyższenia jego oporności to aktywność proteaz. Ujawnienie zapewnia sposoby modyfikowania enzymu według wynalazku, np. przez mutację jego sekwencji kodującej, np. przez GSSM?, aby zmodyfikować wykorzystywanie przez enzym chelatorów metali specyficznych dla Ca, Mg, Na, które nie będą chelatować Zn. Ujawnienie zapewnia sposoby modyfikowania enzymu według wynalazku, np. przez mutację jego sekwencji kodującej, np. przez GSSM?, w celu otrzymania pożądanej kombinacji aktywności, np. PLC specyficznych dla PI, PA i PC/PE. [0234] Te sposoby mogą być powtarzane lub stosowane w różnych kombinacjach w celu wygenerowania enzymów fosfolipazy mających zmienioną lub inną aktywność lub zmienioną -72- lub inną stabilność od tej dla fosfolipazy kodowanej przez matrycę kwasu nukleinowego. Te sposoby można również powtarzać lub stosować w różnych kombinacjach, np. w celu wygenerowania wariacji w ekspresji genu/informacji, translacji informacji lub stabilności informacji. W innym aspekcie, genetyczną kompozycję komórki zmienia się np. przez modyfikację homologicznego genu ex vivo, a następnie wprowadzenie go z powrotem do komórki. [0235] Kwas nukleinowy według wynalazku można zmieniać dowolnymi sposobami. Na przykład, sposobami losowymi lub stochastycznymi, lub niestochastycznymi, bądź sposobami ?ukierunkowanej ewolucji?. [0236] Sposoby losowego mutowania genów są znane ze stanu techniki, patrz np. Patent US Nr 5,830,696. Na przykład, można stosować mutageny do losowego mutowania genu. Mutageny obejmują, np. światło ultrafioletowe lub promieniowanie gamma lub mutageny chemiczne, np. mitomycynę, kwas azotawy, fotoaktywowane psoraleny, samodzielnie lub w kombinacji, aby indukować rozrywanie DNA podatne na naprawę na drodze rekombinacji. Inne mutageny chemiczne obejmują, na przykład, wodorosiarczyn sodu, kwas azotawy, hydroksyloaminę, hydrazynę lub kwas mrówkowy. Inne mutageny są analogami prekursorów nukleotydów, np. nitrozoguanidyna, 5-bromouracyl, 2-aminopuryna, lub akrydyna. Te środki mogą być dodane do reakcji PCR, zamiast prekursora nukleotydu w ten sposób mutując sekwencję. Można także stosować środki interkalujące takie, jak proflawina, akryflawina, kwinakryna i podobne. [0237] Można stosować dowolną technikę biologii molekularnej, np. losową mutagenezę PCR, patrz np. Rice (1992) Proc. Natl. Acad. Sci. USA 89:5467-5471; lub kombinatoryczną wielokrotną mutagenezę kasetową, patrz np. Crameri (1995) Biotechniques 18:194-196. Alternatywnie, kwasy nukleinowe, np. geny, można składać ponownie po losowej lub ?stochastycznej? fragmentacji, patrz np. Patenty US Nry 6,291,242; 6,287,862; 6,287,861; 5,955,358; 5,830,721; 5,824,514; 5,811,238; 5,605,793. W alternatywnych aspektach, modyfikacje, addycje lub delecje są wprowadzane przez podatny na błędy PCR, tasowanie, kierowaną oligonukleotydami mutagenezę, PCR typu składanie (ang. assembly PCR), mutagenezę za pomocą PCR ?seksualnego? ? z symulowaniem wyniku rekombinacji genetycznej, mutagenezę in vivo, mutagenezę kasetową, rekursywną mutagenezę zespołową, wykładniczą mutagenezę zespołową, mutagenezę miejscowo specyficzną, ponowne składanie genów, mutagenezę typu Gene Site Saturation Mutagenesis? (GSSM?), ponowne składanie syntetyczne z udziałem ligacji (SLR), rekombinację, rekursywną rekombinację sekwencji, modyfikowaną tiofosforanem mutagenezę DNA, mutagenezę zawierającej matrycę uracylową, mutagenezę dupleksu z lukami, mutagenezę naprawczą punktowych niedopasowań, mutagenezę szczepu gospodarza niezdolnego do napraw, mutagenezę chemiczną, mutagenezę radiogeniczną, mutagenezę delecyjną, mutagenezę restrykcyjnoselekcyjną, mutagenezę restrykcyjno-oczyszczającą, syntezę sztucznych genów, mutagenezę zespołową, tworzenie multimerów chimerycznego kwasu nukleinowego i/lub kombinacje tych i innych sposobów. -73- [0238] Poniższe publikacje opisują różne rekurencyjne procedury rekombinacji i/lub sposoby, które mogą być włączone do sposobów według ujawnienia: Stemmer (1999) ?Molecular breeding of viruses for targeting and other clinical properties? Tumor Targeting 4:1-4; Ness (1999) Nature Biotechnology 17:893-896; Chang (1999) ?Evolution of a cytokine using DNA family shuffling? Nature Biotechnology 17:793-797; Minshull (1999) ?Protein evolution by molecular breeding? Current Opinion in Chemical Biology 3:284-290; Christians (1999) ?Directed evolution of thymidine kinase for AZT phosphorylation using DNA family shuffling? Nature Biotechnology 17:259-264; Crameri (1998) ?DNA shuffling of a family of genes from diverse species accelerates directed evolution? Nature 391:288-291; Crameri (1997) ?Molecular evolution of an arsenate detoxification pathway by DNA shuffling,? Nature Biotechnology 15:436-438; Zhang (1997) ?Directed evolution of an effective fucosidase from a galactosidase by DNA shuffling and screening? Proc. Natl. Acad. Sci. USA 94:4504-4509; Patten i wsp. (1997) ?Applications of DNA Shuffling to Pharmaceuticals and Vaccines? Current Opinion in Biotechnology 8:724-733; Crameri i wsp. (1996) ?Construction and evolution of antibody-phage libraries by DNA shuffling? Nature Medicine 2:100-103; Crameri i wsp. (1996) ?Improved green fluorescent protein by molecular evolution using DNA shuffling? Nature Biotechnology 14:315-319; Gates i wsp. (1996) ?Affinity selective isolation of ligands from peptide libraries through display on a lac repressor 'headpiece dimer'? Journal of Molecular Biology 255:373-386; Stemmer (1996) ?Sexual PCR and Assembly PCR? In: The Encyclopedia of Molecular Biology. VCH Publishers, New York. str.447-457; Crameri and Stemmer (1995) ?Combinatorial multiple cassette mutagenesis creates all the permutations of mutant and wildtype cassettes? BioTechniques 18:194-195; Stemmer i wsp. (1995) ?Single-step assembly of a gene and entire plasmid form large numbers of oligodeoxyribonucleotides? Gene, 164:49-53; Stemmer (1995) ?The Evolution of Molecular Computation? Science 270: 1510; Stemmer (1995) ?Searching Sequence Space? Bio/Technology 13:549-553; Stemmer (1994) ?Rapid evolution of a protein in vitro by DNA shuffling? Nature 370:389-391; i Stemmer (1994) ?DNA shuffling by random fragmentation and reassembly: In vitro recombination for molecular evolution.? Proc. Natl. Acad. Sci. USA 91:10747-10751. [0239] Metody mutacyjne generowania różnorodności obejmują, przykładowo, mutagenezę ukierunkowaną miejscowo (Ling i wsp. (1997) ?Approaches to DNA mutagenesis: an overview? Anal Biochem. 254(2): 157-178; Dale i wsp. (1996) ?Oligonucleotide-directed random mutagenesis using the phosphorothioate method? Methods Mol. Biol. 57:369-374; Smith (1985) ?In vitro mutagenesis? Ann. Rev. Genet. 19:423-462; Botstein & Shortle (1985) ?Strategies and applications of in vitro mutagenesis? Science 229:1193-1201; Carter (1986) ?Site-directed mutagenesis? Biochem. J. 237:1-7; i Kunkel (1987) ?The efficiency of oligonucleotide directed mutagenesis? in Nucleic Acids & Molecular Biology (Eckstein, F. i Lilley, D. M. J. eds., Springer Verlag, Berlin)); mutagenezę przy użyciu matryc uracylowych (Kunkel (1985) ?Rapid and efficient site-specific mutagenesis without phenotypic selection? Proc. Natl. Acad. Sci. USA 82:488-492; Kunkel i wsp. (1987) ?Rapid and efficient sitespecific mutagenesis without phenotypic selection? Methods in Enzymol. 154, 367-382; i Bass i wsp. (1988) ?Mutant Trp repressors with new DNA-binding specificities? Science -74- 242:240-245); mutagenezę ukierunkowaną oligonukleotydami (Methods in Enzymol. 100: 468-500 (1983); Methods in Enzymol. 154: 329-350 (1987); Zoller & Smith (1982) ?Oligonucleotide-directed mutagenesis using M13-derived vectors: an efficient and general procedure for the production of point mutations in any DNA fragment? Nucleic Acids Res. 10:6487-6500; Zoller & Smith (1983) ?Oligonucleotide-directed mutagenesis of DNA fragments cloned into M13 vectors? Methods in Enzymol. 100:468-500; i Zoller & Smith (1987) ?Oligonucleotide-directed mutagenesis: a simple method using two oligonucleotide primers and a single-stranded DNA template? Methods in Enzymol. 154:329-350); mutagenezę DNA modyfikowanym tiofosforanem (Taylor i wsp. (1985) ?The use of phosphorothioate-modified DNA in restriction enzyme reactions to prepare nicked DNA? Nucl. Acids Res. 13: 8749-8764; Taylor i wsp. (1985) ?The rapid generation of oligonucleotide-directed mutations at high frequency using phosphorothioate-modified DNA? Nucl. Acids Res. 13: 8765-8787 (1985); Nakamaye (1986) ?Inhibition of restriction endonuclease Nci I cleavage by phosphorothioate groups and its application to oligonucleotide-directed mutagenesis? Nucl. Acids Res. 14: 9679-9698; Sayers i wsp. (1988) ?Y-T Exonucleases in phosphorothioate-based oligonucleotide-directed mutagenesis? Nucl. Acids Res. 16:791-802; i Sayers i wsp. (1988) ?Strand specific cleavage of phosphorothioatecontaining DNA by reaction with restriction endonucleases in the presence of ethidium bromide? Nucl. Acids Res. 16: 803-814); mutagenezę z wykorzystaniem dupleksowego DNA z lukami (ang. gapped duplex DNA) (Kramer i wsp. (1984) ?The gapped duplex DNA approach to oligonucleotide-directed mutation construction? Nucl. Acids Res. 12: 9441-9456; Kramer & Fritz (1987) Methods in Enzymol. ?Oligonucleotide-directed construction of mutations via gapped duplex DNA? 154:350-367; Kramer i wsp. (1988) ?Improved enzymatic in vitro reactions in the gapped duplex DNA approach to oligonucleotide-directed construction of mutations? Nucl. Acids Res. 16: 7207; i Fritz i wsp. (1988) ?Oligonucleotidedirected construction of mutations: a gapped duplex DNA procedure without enzymatic reactions in vitro? Nucl. Acids Res. 16: 6987-6999). [0240] Inne protokoły stosowane w praktykowaniu sposobów według ujawnienia obejmują naprawę punktowych niedopasowań (Kramer (1984) ?Point Mismatch Repair? Cell 38:879887), mutagenezę przy użyciu szczepów gospodarza z niedoborem naprawy (Carter i wsp. (1985) ?Improved oligonucleotide site-directed mutagenesis using M13 vectors? Nucl. Acids Res. 13: 4431-4443; i Carter (1987) ?Improved oligonucleotide-directed mutagenesis using M13 vectors? Methods in Enzymol. 154: 382-403), mutagenezę delecyjną (Eghtedarzadeh (1986) ?Use of oligonucleotides to generate large deletions? Nucl. Acids Res. 14: 5115), restrykcję-selekcję oraz restrykcję-selekcję i restrykcję-oczyszczanie (Wells i wsp. (1986) ?Importance of hydrogen-bond formation in stabilizing the transition state of subtilisin? Phil. Trans. R. Soc. Lond. A 317: 415-423), mutagenezę przez całkowitą syntezę genu (Nambiar i wsp. (1984) ?Total synthesis and cloning of a gene coding for the ribonuclease S protein? Science 223: 1299-1301; Sakamar i Khorana (1988) ?Total synthesis and expression of a gene for the a-subunit of bovine rod outer segment guanine nucleotide-binding protein (transducin)? Nucl. Acids Res. 14: 6361-6372; Wells i wsp. (1985) ?Cassette mutagenesis: an efficient method for generation of multiple mutations at defined sites? Gene 34:315-323; i -75- Grundstrom i wsp. (1985) ?Oligonucleotide-directed mutagenesis by microscale 'shot-gun' gene synthesis? Nucl. Acids Res. 13: 3305-3316), naprawę pęknięć podwójnej nici (ang. double-strand break repair) (Mandecki (1986); Arnold (1993) ?Protein engineering for unusual environments? Current Opinion in Biotechnology 4:450-455. ?Oligonucleotidedirected double-strand break repair in plasmids of Escherichia coli: a method for site-specific mutagenesis? Proc. Natl. Acad. Sci. USA, 83:7177-7181). Dodatkowe informacje na temat wielu powyższych metod można znaleźć w Methods in Enzymology Volume 154, które opisuje również przydatne kontrole dla lokalizacji problemów z różnymi metodami mutagenezy. [0241] Patrz także Patenty US Nry 5,605,793 dla Stemmer (25 luty 1997), ?Methods for In Vitro Recombination?; Patent US Nr 5,811,238 dla Stemmer i wsp. (22 wrzesień 1998) ?Methods for Generating Polynucleotides having Desired Characteristics by Iterative Selection and Recombination?; Patent US Nr 5,830,721 dla Stemmer i wsp. (3 listopad 1998), ?DNA Mutagenesis by Random Fragmentation and Reassembly?; Patent US Nr 5,834,252 dla Stemmer, i wsp. (10 listopad 1998) ?End-Complementary Polymerase Reaction?; Patent US Nr 5,837,458 dla Minshull, i wsp. (17 listopad 1998), ?Methods and Compositions for Cellular and Metabolic Engineering?; WO 95/22625, Stemmer i Crameri, ?Mutagenesis by Random Fragmentation and Reassembly?; WO 96/33207 przez Stemmer i Lipschutz ?End Complementary Reakcja łańcuchowa polimerazy?; WO 97/20078 przez Stemmer i Crameri ?Methods for Generating Polynucleotides having Desired Characteristics by Iterative Selection and Recombination?; WO 97/35966 przez Minshull i Stemmer, ?Methods and Compositions for Cellular and Metabolic Engineering?; WO 99/41402 przez Punnonen i wsp. ?Targeting of Genetic Vaccine Vectors?; WO 99/41383 przez Punnonen i wsp. ?Antigen Library Immunization?; WO 99/41369 przez Punnonen i wsp. ?Genetic Vaccine Vector Engineering?; WO 99/41368 przez Punnonen i wsp. ?Optimization of Immunomodulatory Properties of Genetic Vaccines?; EP 752008 przez Stemmer i Crameri, ?DNA Mutagenesis by Random Fragmentation and Reassembly?; EP 0932670 przez Stemmer ?Evolving Cellular DNA Uptake by Recursive Sequence Recombination?; WO 99/23107 przez Stemmer i wsp., ?Modification of Virus Tropism and Host Range by Viral Genome Shuffling?; WO 99/21979 by Apt i wsp., ?Human Papillomavirus Vectors?; WO 98/31837 przez del Cardayre i wsp. ?Evolution of Whole Cells and Organisms by Recursive Sequence Recombination?; WO 98/27230 przez Patten i Stemmer, ?Methods and Compositions for Polypeptide Engineering?; WO 98/27230 przez Stemmer i wsp., ?Methods for Optimization of Gene Therapy by Recursive Sequence Shuffling and Selection?, WO 00/00632, ?Methods for Generating Highly Diverse Libraries?, WO 00/09679, ?Methods for Obtaining in Vitro Recombined Polynucleotide Sequence Banks and Resulting Sequences?, WO 98/42832 przez Arnold i wsp., ?Recombination of Polynucleotide Sequences Using Random or Defined Primers?, WO 99/29902 przez Arnold i wsp., ?Method for Creating Polynucleotide and Polypeptide Sequences?, WO 98/41653 przez Vind, ?An in vitro Method for Construction of a DNA Library?, WO 98/41622 przez Borchert i wsp., ?Method for Constructing a Library Using DNA Shuffling?, i WO 98/42727 przez Pati i Zarling, ?Sequence Alterations using Homologous Recombination.? -76- [0242] Pewne zgłoszenia US podają dodatkowe szczegóły w odniesieniu do różnorodności różnych metod wytwarzania, w tym ?SHUFFLING OF CODON ALTERED GENES? przez Patten i wsp. złożone 28 wrz. 1999, (Nr Ser. US 09/407,800); ?EVOLUTION OF WHOLE CELLS AND ORGANISMS BY RECURSIVE SEQUENCE RECOMBINATION? przez del Cardayre i wsp., złożony 15 lip. 1998 (Nr Ser. US 09/166,188), i 15 lip. 1999 (Nr Ser. US 09/354,922); ?OLIGONUCLEOTIDE MEDIATED NUCLEIC ACID RECOMBINATION? przez Crameri i wsp., złożone 28 wrz. 1999 (Nr Ser. US 09/408,392), i ?OLIGONUCLEOTIDE MEDIATED NUCLEIC ACID RECOMBINATION? przez Crameri i wsp., złożony 18 sty. 2000 (PCT/US00/01203); ?USE OF CODON-VARIED OLIGONUCLEOTIDE SYNTHESIS FOR SYNTHETIC SHUFFLING? przez Welch i wsp., złożone 28 wrz. 1999 (Nr Ser. US 09/408,393); ?METHODS FOR MAKING CHARACTER STRINGS, POLYNUCLEOTIDES & POLYPEPTIDES HAVING DESIRED CHARACTERISTICS? przez Selifonov i wsp., złożony 18 sty. 2000, (PCT/US00/01202) i np. ?METHODS FOR MAKING CHARACTER STRINGS, POLYNUCLEOTIDES & POLYPEPTIDES HAVING DESIRED CHARACTERISTICS? przez Selifonov i wsp., złożony 18 lip. 2000 (Nr Ser. US 09/618,579); ?METHODS OF POPULATING DATA STRUCTURES FOR USE IN EVOLUTIONARY SIMULATIONS? przez Selifonov i Stemmer, złożony 18 sty. 2000 (PCT/US00/01138); i ?SINGLE-STRANDED NUCLEIC ACID TEMPLATE-MEDIATED RECOMBINATION AND NUCLEIC ACID FRAGMENT ISOLATION? przez Affholter, złożony 6 wrz. 2000 (Nr Ser. US 09/656,549). [0243] Sposoby niestochastycznej, lub ?ukierunkowanej ewolucji? obejmują, np. mutagenezę nasyceniową (np. GSSM?), ponowne składanie syntetyczne z udziałem ligacji (SLR), lub ich kombinacje, i są stosowane do modyfikowania kwasów nukleinowych według wynalazku, w celu wygenerowania fosfolipaz o nowych lub zmienionych właściwościach (np. aktywność w warunkach wysoce kwasowych lub alkalicznych, wysokich temperaturach, i podobne). Polipeptydy kodowane przez modyfikowane kwasy nukleinowe można badać przesiewowo pod kątem aktywności przed testowaniem na aktywność fosfolipazy lub inną aktywność. Można stosować dowolne modalności lub protokoły do testowania, np. przy użyciu platformy macierzy kapilarnej. Patrz np. Patenty US Nry 6,280,926; US 5,939,250. Mutageneza nasyceniowa, lub, GSSM? [0244] Niestochastyczną modyfikację genów, ?ukierunkowany proces ewolucji? stosuje się w celu wygenerowania fosfolipaz o nowych lub zmienionych właściwościach. Wariacje tego sposobu nazwano ?mutagenezą miejsc genowych? ?ukierunkowaną mutagenezą nasyceniową? ?mutagenezą nasyceniową miejsc genowych? lub po prostu ?GSSM??. Można ją stosować w kombinacji z innymi procesami mutagenizacji. Patrz np. Patenty US Nry 6,171,820; US 6,238,884. W jednym aspekcie, GSSM? obejmuje zapewnienie matrycowego polinukleotydu i szeregu oligonukleotydów, przy czym każdy oligonukleotyd zawiera sekwencję homologicznych polinukleotydów matrycy, w ten sposób kierując na określoną sekwencję matrycowego polinukleotydu oraz sekwencję, która jest wariantem genu homologicznego; tworzenie polinukleotydów potomnych zawierających niestochastyczne -77- wariacie sekwencji przez replikację matrycowego polinukleotydu z oligonukleotydami, tworząc w ten sposób polinukleotydy zawierające homologiczny wariacje sekwencji genu. [0245] Startery kodonów zawierające zdegenerowaną sekwencję N,N,G/T służą do wprowadzenia mutacji punktowych do polinukleotydu, w celu wygenerowania zestawu potomnych polipeptydów, w których pełny zakres podstawień pojedynczych aminokwasów jest reprezentowany w każdej pozycji aminokwasowej, np. reszta aminokwasowa w miejscu aktywnym enzymu lub reszta miejsca wiązania ligandu skierowana do modyfikowania. Te oligonukleotydy mogą zawierać ciągłą pierwszą sekwencję homologiczną, zdegenerowaną sekwencję N,N,G/T, i, ewentualnie, drugą sekwencję homologiczną. Dalsze produkty translacyjne potomstwa z zastosowania takich oligonukleotydów obejmują wszystkie możliwe zmiany aminokwasowe w każdym miejscu wzdłuż aminokwasów polipeptydu, ponieważ degeneracja sekwencji N,N,G/T zawiera kodony dla wszystkich 20 aminokwasów. W jednym aspekcie, jeden taki zdegenerowany oligonukleotyd (złożony z np. jednej zdegenerowanej kastety N,N,G/T) stosuje się do poddawania każdego oryginalnego kodonu w macierzystej matrycy polinukleotydowej pełnemu zakresowi podstawień kodonów. W innym aspekcie, stosuje się co najmniej dwie zdegenerowane kasety - albo w tym samym oligonukleotydzie albo nie tym samym, dla poddawania co najmniej dwóch oryginalnych kodonów w macierzystej matrycy polinukleotydowej pełnemu zakresowi podstawień kodonów. Na przykład, więcej niż jedna sekwencja N,N,G/T może być zawarta w jednym oligonukleotydzie do wprowadzenia mutacji aminokwasowych w więcej niż jednym miejscu. Ten szereg sekwencji N,N,G/T może być bezpośrednio ciągły, lub rozdzielony jedną lub większą liczbą dodatkowych sekwencji nukleotydowych. W innym aspekcie, oligonukleotydy użyteczne dla wprowadzenia addycji i delecji można stosować same lub w połączeniu z kodonami zawierającymi sekwencję N,N,G/T, aby wprowadzać dowolną kombinację lub permutację aminokwasowych addycji, delecji i/lub podstawień. [0246] Wykonuje się jednoczesną mutagenezę dwóch lub większej liczby położeń aminokwasowych za pomocą oligonukleotydu, który zawiera ciągły tryplet N,N,G/T, tj. zdegenerowaną sekwencję (N,N,G/T)n. W innym aspekcie, stosuje się zdegenerowane kasety mające mniej degeneracji niż sekwencja N,N,G/T. Na przykład, w niektórych przypadkach może być pożądane aby stosować (np. w oligonukleotydzie) zdegenerowaną sekwencję trypletu składającą się tylko z jednego N, przy czym wymieniony N może być w pierwszym, drugim lub trzecim położeniu trypletu. Wszelkie inne zasady, w tym ich wszelkie kombinacje i permutacje mogą być stosowane w dwóch pozostałych pozycjach trypletu. Alternatywnie, w niektórych przypadkach może być pożądane aby stosować (np. w oligo) zdegenerowaną sekwencję trypletu N,N,N. [0247] Zastosowanie zdegenerowanych trypletów (np. trypletów N,N,G/T) pozwala na systematyczne i łatwe generowanie pełnego zakresu możliwych naturalnych aminokwasów (dla w sumie 20 aminokwasów) w każdej pozycji aminokwasowej w polipeptydzie (w alternatywnych aspektach, sposoby obejmują również generowanie mniej niż wszystkich możliwych podstawień na resztę aminokwasu lub kodon, pozycję). Na przykład, dla 100 aminokwasowego polipeptydu, można wygenerować 2000 odrębnych form (tj. 20 możliwych -78- aminokwasów na pozycję X 100 pozycji aminokwasowych). Przez zastosowanie oligonukleotydu lub zestawu oligonukleotydów zawierających zdegenerowany tryplet N,N,G/T, 32 indywidualne sekwencje mogą kodować wszystkich 20 możliwych aminokwasów naturalnych. Zatem, w naczyniu reakcyjnym, w którym macierzysta sekwencja polinukleotydowa jest poddawana mutagenezie nasyceniowej z użyciem co najmniej jednego takiego oligonukleotydu, generowanych jest 32 różnych potomnych polinukleotydów kodujących 20 różnych polipeptydów. W przeciwieństwie do tego, zastosowanie niezdegenerowanego oligonukleotydu w mutagenezie ukierunkowanej miejscowo prowadzi tylko do jednego produktu polipeptydowego potomnego na naczynie reakcyjne. Niezdegenerowane oligonukleotydy można ewentualnie stosować w połączeniu z ujawnionymi starterami zdegenerowanymi; na przykład, niezdegenerowane oligonukleotydy można stosować do wytwarzania konkretnych mutacji punktowych w polinukleotydzie roboczym. Zapewnia to jeden ze sposobów generowania specyficznych cichych mutacji punktowych, mutacji punktowych prowadzących do odpowiednich zmian aminokwasowych i mutacji punktowych, które powodują generację kodonów stopu i odpowiednią ekspresję fragmentów polipeptydowych. [0248] Każde naczynie reakcyjne mutagenezy nasyceniowej zawiera polinukleotydy kodujące co najmniej 20 cząsteczek potomnych polipeptydów (np. fosfolipaza) tak, że wszystkie 20 występujących w przyrodzie aminokwasów przedstawia się w jednej specyficznej pozycji aminokwasowej odpowiadającej pozycji kodonu mutagenizowanego w macierzystym polinukleotydzie (inne aspekty wykorzystują mniej niż 20 naturalnych kombinacji). 32-krotne zdegenerowane polipeptydy potomne wygenerowane z każdego naczynia reakcyjnego mutagenezy nasyceniowej można poddać klonalnej amplifikacji (np. sklonować do odpowiedniego gospodarza, np. gospodarza E. coli, przy użyciu, na przykład, wektora ekspresyjnego) i poddać badaniu przesiewowemu ekspresji. Kiedy indywidualny polipeptyd potomny zostaje zidentyfikowany przez badanie przesiewowe jako prezentujący pozytywną zmianę własności (w porównaniu z polipeptydem macierzystym, jak zwiększona aktywność fosfolipazy w warunkach zasadowych lub kwasowych), można go zsekwencjonować w celu zidentyfikowania odpowiedniego korzystnego podstawienia aminokwasowego w nim zawartego. [0249] Po mutagenizacji każdej pozycji aminokwasowej w macierzystym polipeptydzie za pomocą mutagenezy nasyceniowej tu ujawnionej, korzystne zmiany aminokwasowe można zidentyfikować w więcej niż jednej pozycji aminokwasowej. Można wytwarzać jedną lub więcej nowych potomnych cząsteczek, które zawierają kombinację całości lub części z tych korzystnych podstawień aminokwasowych. Na przykład, jeśli 2 specyficzne korzystne zmiany aminokwasowe identyfikuje się w każdej z 3 pozycji aminokwasowych w polipeptydzie, permutacje obejmują 3 możliwości w każdej pozycji (bez zmian w stosunku do oryginalnego aminokwasu i każdej z dwóch korzystnych zmian) i 3 pozycje. Zatem istnieje 3 x 3 x 3 lub 27 możliwości łączne, w tym 7, które były wcześniej badane - 6 mutacji pojedynczego punktu (to znaczy 2 na każdej z trzech pozycji) i brak zmian w dowolnej pozycji. -79- [0250] Mutagenezę nasyceniową miejsc można stosować wraz z innymi sposobami stochastycznymi lub niestochastycznymi dla otrzymania zmienności sekwencji, np. ponownym składaniem syntetycznym z udziałem ligacji (patrz poniżej), tasowaniem, chimeryzacją, rekombinacją i innymi procesami mutagenizacji i środkami do mutagenizacji. Ujawnienie to zapewnia zastosowanie dowolnego procesu mutagenizacji, w tym mutagenezy nasyceniowej, w sposób iteracyjny. Ponowne Składanie Syntetyczne z Udziałem Ligacji (SLR) [0251] Ujawnienie zapewnia niestochastyczny system do modyfikacji genów nazwany ?ponowne składanie syntetyczne z udziałem ligacji? lub po prostu ?SLR?, ?ukierunkowany proces ewolucji? w celu wygenerowania fosfolipaz o nowych lub zmienionych właściwościach. SLR to sposób niestochastycznego ligowania ze sobą fragmentów oligonukleotydów. Ten sposób różni się od stochastycznego tasowania oligonukleotydów pod tym względem, że bloki budulcowe kwasu nukleinowego nie są tasowane, łączone lub chimeryzowane losowo, ale są raczej łączone niestochastycznie. Patrz np. Zgłoszenie Patentowe US Nr (USSN) 09/332,835 pod tytułem ?Synthetic Ligation Reassembly in Directed Evolution?, zgłoszone 14 czerwca 1999 r. (?USSN 09/332,835?). W jednym aspekcie, SLR obejmuje następujące etapy: (a) zapewniania matrycy polinukleotydu, przy czym matryca polinukleotydu zawiera sekwencję kodującą gen homologiczny; (b) zapewniania wielu bloków budulcowych polinukleotydowych, przy czym bloki budulcowe polinukleotydowe są przeznaczone do ponownego składania w drodze cross-over z matrycą polinukleotydu w z góry określonej sekwencji, i blok budulcowy polinukleotydowy zawiera sekwencję, która jest wariantem genu homologicznego oraz sekwencję homologiczną do matrycy polinukleotydu flankującego sekwencję wariantu; (c) połączenie bloku budulcowego polinukleotydowego z matrycą polinukleotydu tak, że blok budulcowy polinukleotydowy formuje się ponownie w drodze cross-over z matrycą polinukleotydu w celu wytworzenia polinukleotydów zawierających wariacje sekwencji genów homologicznych. [0252] SLR nie zależy od obecności wysokich poziomów homologii między polinukleotydami do przegrupowania. Zatem sposób ten można stosować do niestochastycznego generowania bibliotek (lub zestawów) cząsteczek potomnych złożonych z ponad 10100 różnych chimer. SLR można stosować do wytwarzania bibliotek złożonych z ponad 101000 różnych chimer potomstwa. Tak więc, aspekty według niniejszego ujawnienia obejmują niestochastyczne sposoby wytwarzania zestawu zakończonych chimerycznych cząsteczek kwasu nukleinowego mających ogólną kolejność łączenia, która jest wybierana projektem. Sposób ten obejmuje etapy generowania poprzez projektowanie wielu poszczególnych bloków budulcowych kwasu nukleinowego mających przydatne wzajemnie zgodne końce, które mogą ulegać ligacji i łączenie tych bloków budulcowych kwasu nukleinowego tak, że osiąga się zaprojektowaną całkowitą kolejność łączenia. [0253] Wzajemnie zgodne końce, które mogą ulegać ligacji, bloków budulcowych kwasu nukleinowego do połączenia są uważane za ?przydatne? dla tego typu uporządkowanego łączenia, jeśli umożliwiają blokom budulcowym sprzęganie w ustalonych kolejnościach. Zatem, kolejność całkowitego łączenia, z którą bloki budulcowe kwasu nukleinowego są -80- sprzęgane, jest określona przez projekt końców, które mogą ulegać ligacji. Jeśli więcej niż jeden etap łączenia ma być stosowany, wówczas kolejność całkowitego łączenia, z którą bloki budulcowe kwasu nukleinowego są sprzęgane, jest również określona przez kolejność sekwencyjną etapu(-ów) łączenia. W jednym aspekcie, stapiane fragmenty budulcowe traktuje się enzymem, takim, jak ligaza (np. ligaza DNA T4), do uzyskania utworzenia wiązań kowalencyjnych z elementów budulcowych. [0254] Projekt oligonukleotydowych bloków budulcowych uzyskuje się analizując zestaw matryc sekwencji kwasu nukleinowego protoplasty, który służy jako podstawa do produkcji zestawu potomstwa sfinalizowanych chimerycznych polinukleotydów. Więc te macierzyste matryce oligonukleotydowe służą jako źródło informacji o sekwencji, które pomaga w projektowaniu bloków budulcowych kwasu nukleinowego które mają być mutagenizowane, np. chimeryzowane lub tasowane. [0255] W jednym aspekcie tego sposobu, sekwencje wielu macierzystych matryc kwasów nukleinowych dopasowuje się, aby wybrać jeden lub więcej punktów rozgraniczających. Punkty rozgraniczające mogą znajdować się w obszarze homologii i składają się z jednego lub większej liczby nukleotydów. Te punkty rozgraniczające są korzystnie wspólne dla co najmniej dwóch spośród matryc protoplastów. Punkty rozgraniczające w ten sposób można wykorzystać do wyznaczenia granic oligonukleotydowych bloków budulcowych do wygenerowania w celu przegrupowania polinukleotydów macierzystych. Punkty rozgraniczające zidentyfikowane i wybrane w cząsteczkach protoplasty służą jako potencjalne punkty chimeryzacji przy łączeniu końcowych chimerycznych cząsteczek potomnych. Punkt rozgraniczający może być obszarem homologii (składającym się z co najmniej jednej homologicznej zasady nukleotydowej) wspólnym dla co najmniej dwóch macierzystych sekwencji polinukleotydowych. Alternatywnie, punkt rozgraniczający może być obszarem homologii, który jest wspólny dla co najmniej połowy macierzystych sekwencji polinukleotydowych, lub, może być obszarem homologii, który jest wspólny dla co najmniej dwóch trzecich macierzystych sekwencji polinukleotydowych. Jeszcze bardziej korzystnie przydatne punkty rozgraniczające są obszarem homologii, który jest wspólny dla co najmniej trzech czwartych macierzystych sekwencji polinukleotydowych, lub, może być wspólny dla prawie wszystkich macierzystych sekwencji polinukleotydowych. W jednym aspekcie, punkt rozgraniczający jest obszarem homologii, który jest wspólny dla wszystkich macierzystych sekwencji polinukleotydowych. [0256] Proces ponownego składania z udziałem ligacji przeprowadza się w sposób wyczerpujący w celu wygenerowania wyczerpującej biblioteki potomnych chimerycznych polinukleotydów. Innymi słowy, wszystkie możliwe uporządkowane kombinacje bloków budulcowych kwasu nukleinowego są przedstawione w zestawie sfinalizowanych chimerycznych cząsteczek kwasu nukleinowego. W tym samym czasie, w innym przykładzie wykonania, kolejność łączenia (tj. kolejność łączenia każdego bloku budulcowego w sekwencji 5? do 3? każdego sfinalizowanego chimerycznego kwasu nukleinowego) w każdej kombinacji odbywa się według projektu (lub niestochastycznie) jak opisano powyżej. Ze -81- względu na charakter niestochastyczny według tego ujawnienia, możliwość niepożądanych produktów ubocznych jest znacznie zmniejszona. [0257] Metodę ponownego składania z udziałem ligacji można wykonywać systematycznie. Na przykład, sposób przeprowadza się w celu wytworzenia biblioteki z systematycznymi segmentami potomnych cząsteczek, z przegrodami, które można przeszukiwać systematycznie, np. jeden po drugim. Innymi słowy to ujawnienie zapewnia, że poprzez selektywne i rozsądne wykorzystanie konkretnych bloków budulcowych kwasu nukleinowego, w połączeniu z selektywnym i rozsądnym korzystaniem z kolejnych reakcji łączenia, można osiągnąć projekt, w którym specyficzne zestawy produktów potomnych wykonuje się w każdym z kilku naczyń reakcyjnych. Pozwala to na wykonanie procedury systematycznego badania i przesiewania. Zatem, sposoby te pozwalają potencjalnie bardzo dużej liczbie potomnych cząsteczek na ich przebadanie systematycznie w mniejszych grupach. Ze względu na ich zdolność do wykonywania chimeryzacji w taki sposób, który jest bardzo elastyczny a jednak wyczerpujący, a także systematyczny, szczególnie, gdy jest niski poziom homologii pomiędzy cząsteczkami protoplasty, sposoby te przewidują tworzenie biblioteki (lub zestawu) złożonego z dużej liczby potomnych cząsteczek. Ze względu na charakter niestochastyczny ponownego składania z udziałem ligacji, cząsteczki potomne generowane korzystnie obejmują bibliotekę sfinalizowanych chimerycznych cząsteczek kwasu nukleinowego mających całkowitą kolejność łączenia wybraną przez projekt. Metody mutagenezy nasyceniowej i zoptymalizowanej ewolucji ukierunkowanej mogą być również stosowane do generowania różnych form molekularnych potomstwa. Należy zauważyć, że ujawnienie zapewnia wolność wyboru i kontroli dotyczących wyboru punktów rozgraniczających, wielkości i liczby bloków budulcowych kwasu nukleinowego, oraz wielkość i projektu sprzęgań. Należy zauważyć, ponadto, że wymóg homologii międzycząsteczkowych jest wysoce zrelaksowany dla funkcjonalności według tego ujawnienia. W rzeczywistości, punkty rozgraniczające można wybrać nawet w obszarach o małej lub żadnej homologii międzycząsteczkowej. Na przykład, ze względu na kodon wobble, tj. degenerację kodonów, podstawienia nukleotydów można wprowadzać do bloków budulcowych kwasów nukleinowych bez zmiany aminokwasu początkowo kodowanego w odpowiedniej matrycy progenitorowej. Alternatywnie, kodon można zmieniać tak, że zmieniane jest kodowanie pierwotnego aminokwasu. To ujawnienie zapewnia, że takie podstawienia można wprowadzać do bloku budulcowego kwasu nukleinowego w celu zwiększenia częstości występowania punktów rozgraniczających homologii międzycząsteczkowej i tak, aby umożliwić osiągnięcie większej liczby sprzęgań wśród bloków budulcowych, co z kolei pozwala na wygenerowanie większej liczby potomnych cząsteczek chimerycznych. [0258] Syntetyczny charakter etapu, w którym bloki budulcowe są wytwarzane, umożliwia projektowi i wprowadza nukleotydy (np. jeden lub większa liczba nukleotydów, które mogą być, na przykład, kodonami lub intronami lub sekwencjami regulatorowymi), które później można ewentualnie usunąć w procesie in vitro (np. przez mutagenezę) lub w procesie in vivo (np. wykorzystując zdolność składania genu organizmu gospodarza). Należy zauważyć, że w -82- wielu przypadkach, wprowadzenie tych nukleotydów może być pożądane z wielu innych powodów oprócz potencjalnych korzyści tworzenia przydatnego punktu rozgraniczającego. [0259] Blok budulcowy kwas nukleinowy służy do wprowadzenia intronu. Tak więc, funkcjonalne introny wprowadza się do genu wytworzonego przez człowieka zgodnie z opisanymi tu metodami. Sztucznie wprowadzone intron(y) mogą być funkcjonalne w komórkach gospodarza dla składania genu znacznie w sposób, w który naturalnie występujące introny służą funkcjonalnie w składaniu genu. Optymizowany Układ Ukierunkowanej Ewolucji [0260] Ujawnienie zapewnia niestochastyczny system do modyfikacji genów nazwany ?optymizowanym układem ukierunkowanej ewolucji? w celu wygenerowania fosfolipaz o nowych lub zmienionych właściwościach. Optymizowana ukierunkowana ewolucja dotyczy stosowania powtarzanych cykli redukcyjnej reasortacji, rekombinacji i selekcji, które umożliwiają otrzymanie ukierunkowanej ewolucji molekularnej kwasów nukleinowych na drodze rekombinacji. Optymizowana ukierunkowana ewolucja umożliwia generowanie dużej populacji wyewoluowanych chimerycznych sekwencji, przy czym generowana populacja jest istotnie wzbogacona o sekwencje, które mają określoną z góry liczbę zdarzeń typu crossover. [0261] Zdarzenie crossover jest punktem w sekwencji chimerycznej, gdzie następuje przesunięcie w sekwencji od jednego wariantu macierzystego do drugiego wariantu macierzystego. Taki punkt jest normalnie w miejscu połączenia, gdzie oligonukleotydy od dwóch rodziców ulegają razem ligacji w celu wytworzenia pojedynczej sekwencji. Metoda ta pozwala na obliczenie odpowiednich stężeń sekwencji oligonukleotydowych tak, że końcowa populacja chimeryczna sekwencji jest wzbogacona dla wybranej liczby zdarzeń crossover. Zapewnia to większą kontrolę nad wyborem wariantów chimerycznych o z góry określonej liczbie zdarzeń crossover. [0262] Ponadto, ta metoda zapewnia dogodne środki do odkrywania ogromnej ilości przestrzeni możliwych wariantów białka w stosunku do innych systemów. Poprzednio, jeśli wygenerowano, na przykład, 1013 chimerycznych cząsteczek podczas reakcji, byłoby bardzo trudne aby zbadać tak dużą liczbę wariantów chimerycznych pod kątem określonego działania. Ponadto znaczna część populacji potomstwa miałaby bardzo wysoką liczbę zdarzeń crossover, co dałoby białka, które nie miały z dużym prawdopodobieństwem zwiększonych poziomów określonej aktywności. Przez zastosowanie tych sposobów, populacja chimerycznych cząsteczek może być wzbogacona w tych wariantach, które mają określoną liczbę zdarzeń crossover. Tak więc, chociaż nadal można wygenerować 1013 chimerycznych cząsteczek podczas reakcji, każda z cząsteczek wybranych do dalszej analizy najprawdopodobniej ma, na przykład tylko trzy zdarzenia crossover. Ponieważ uzyskana populacja potomstwa może być skłonna aby mieć z góry określoną liczbę zdarzeń crossover, granice na funkcjonalnej różności chimerycznych cząsteczek są zmniejszone. Daje to dużo łatwiejsze w zarządzaniu zmienne przy obliczaniu, które oligonukleotydy z oryginalnych polinukleotydów macierzystych mogą być odpowiedzialne za wpływ na szczególną cechę. -83- [0263] Jeden ze sposobów tworzenia chimerycznej potomnej sekwencji polinukleotydowej polega na stworzeniu oligonukleotydów odpowiadających fragmentom lub częściom każdej sekwencji macierzystej. Każdy oligonukleotyd korzystnie zawiera unikalny obszar zachodzenia tak, że mieszanie się oligonukleotydów ze sobą daje nowy wariant, który ma każdy fragment oligonukleotydowy połączony w prawidłowej kolejności. Dodatkowe informacje można również znaleźć, na przykład w USSN 09/332,835. Liczba oligonukleotydów generowanych dla każdego wariantu macierzystego obejmuje relację do ogólnej liczby powstałych crossoverów w cząsteczce chimerycznej, która jest ostatecznie utworzona. Na przykład, można zapewnić trzy warianty macierzystej sekwencji nukleotydowej do poddania reakcji ligacji w celu znalezienia chimerycznego wariantu mającego, na przykład, większą aktywność w podwyższonej temperaturze. Jako jeden przykład, można wygenerować zestaw 50 sekwencji oligonukleotydów odpowiadających każdej części każdego wariantu macierzystego. W związku z tym, w trakcie procesu ponownego składania z udziałem ligacji może istnieć do 50 zdarzeń crossover w ramach każdej z sekwencji chimerycznych. Prawdopodobieństwo, że każdy z wygenerowanych chimerycznych polinukleotydów będzie zawierać oligonukleotydy z każdego wariantu macierzystego w kolejności na przemian jest bardzo niska. Jeśli każdy fragment oligonukleotydowy jest obecny w reakcji ligacji w tej samej ilości molowej możliwe jest, że w niektórych pozycjach oligonukleotydy w tym samym polinukleotydzie macierzystym będą ulegały ligacji obok siebie, a tym samym nie mogą powodować zdarzenia crossover. Jeśli stężenie każdego oligonukleotydu z każdego rodzica utrzymuje się na stałym poziomie w dowolnym etapie ligacji, w tym przykładzie istnieje 1/3 szans (zakładając trzech rodziców), że oligonukleotyd z tego samego wariantu macierzystego ulegnie ligacji w sekwencji chimerycznej i nie da crossover. [0264] W związku z tym można określić funkcję gęstości prawdopodobieństwa (PDF) do przewidywania populacji zdarzeń crossover, które mogą wystąpić w trakcie każdego etapu w reakcji ligacji biorąc pod uwagę liczbę zestawów wariantów macierzystych, liczbę oligonukleotydów odpowiadających każdemu wariantowi i stężenia każdego wariantu podczas każdego etapu w reakcji ligacji. Metody statystyczne i matematyczne dla określenia PDF są opisane poniżej. Dzięki wykorzystaniu tych sposobów, można obliczyć taką funkcję gęstości prawdopodobieństwa, i tym samym wzbogacić chimeryczną populację potomstwa dla z góry określonej liczby zdarzeń crossover wynikających z określonej reakcji ligacji. Ponadto można określić z góry docelową liczbę zdarzeń crossover i system zaprogramować do obliczenia ilości wyjściowych każdego macierzystego oligonukleotydu podczas każdego etapu w reakcji ligacji aby dać funkcję gęstości prawdopodobieństwa, która skupia się na z góry określonej liczbie zdarzeń crossover. Sposoby te kierowane są do stosowania wielokrotnych cykli redukcyjnej reasortacji, rekombinacji i selekcji, które pozwalają na ukierunkowaną ewolucję molekularną kwasu nukleinowego kodujący polipeptyd dzięki rekombinacji. Ten system umożliwia generowanie dużej populacji wyewoluowanych chimerycznych sekwencji, przy czym wygenerowana populacja jest znacznie wzbogacona dla sekwencji, które mają z góry określoną liczbę zdarzeń crossover. Zdarzenie crossover jest punktem w sekwencji chimerycznej gdzie następuje przesunięcie w sekwencji od jednego -84- wariantu macierzystego do drugiego wariantu macierzystego. Taki punkt jest normalnie w miejscu połączenia, gdzie oligonukleotydy od dwóch rodziców ulegają razem ligacji w celu wytworzenia pojedynczej sekwencji. Metoda pozwala na wyliczenie odpowiednich stężeń sekwencji oligonukleotydowych tak, że końcowa populacja chimeryczna sekwencji jest wzbogacona dla wybranej liczby zdarzeń crossover. Zapewnia to większą kontrolę nad wyborem wariantów chimerycznych o z góry określonej liczbie zdarzeń crossover. [0265] Ponadto, metody te zapewniają dogodne środki do odkrywania ogromnej ilości przestrzeni możliwych wariantów białka w stosunku do innych systemów. Stosując metody opisane w niniejszym dokumencie, populacja cząsteczek chimerycznych może być wzbogacona o te warianty, które mają szczególną liczbę zdarzeń crossover. Tak więc, chociaż nadal można generować 1013 chimerycznych cząsteczek podczas reakcji, każda z cząsteczek wybranych do dalszej analizy najprawdopodobniej ma, na przykład, tylko trzy zdarzenia crossover. Ponieważ uzyskana populacja potomstwa może być skłonna aby mieć z góry określoną liczbę zdarzeń crossover, granice na funkcjonalnej różności chimerycznych cząsteczek są zmniejszone. Daje to dużo łatwiejsze w zarządzaniu zmienne przy obliczaniu, które oligonukleotydy z oryginalnych polinukleotydów macierzystych mogą być odpowiedzialne za wpływ na szczególną cechę. [0266] W jednym aspekcie, metoda tworzy chimeryczną sekwencję polinukleotydową potomstwa tworząc oligonukleotydy odpowiadające fragmentom lub częściom z każdej sekwencji macierzystej. Każdy oligonukleotyd korzystnie zawiera unikalny obszar nakładania, dzięki czemu mieszanie oligonukleotydów razem daje nowy wariant, który ma każdy fragment oligonukleotydowy połączony w prawidłowej kolejności. Patrz także USSN 09/332,835. [0267] Liczba oligonukleotydów generowanych dla każdego wariantu macierzystego obejmuje relację do ogólnej liczby powstałych crossoverów w cząsteczce chimerycznej, która jest ostatecznie utworzona. Na przykład, można zapewnić trzy warianty macierzystej sekwencji nukleotydowej do poddania reakcji ligacji w celu znalezienia chimerycznego wariantu mającego, na przykład, większą aktywność w podwyższonej temperaturze. Jako jeden przykład, można wygenerować zestaw 50 sekwencji oligonukleotydów odpowiadających każdej części każdego wariantu macierzystego. W związku z tym, w trakcie procesu ponownego składania z udziałem ligacji może istnieć do 50 zdarzeń crossover w ramach każdej z sekwencji chimerycznych. Prawdopodobieństwo, że każdy z wygenerowanych chimerycznych polinukleotydów będzie zawierać oligonukleotydy z każdego wariantu macierzystego w kolejności na przemian jest bardzo niska. Jeśli każdy fragment oligonukleotydowy jest obecny w reakcji ligacji w tej samej ilości molowej możliwe jest, że w niektórych pozycjach oligonukleotydy w tym samym polinukleotydzie macierzystym będą ulegały ligacji obok siebie, a tym samym nie mogą powodować zdarzenia crossover. Jeśli stężenie każdego oligonukleotydu z każdego rodzica utrzymuje się na stałym poziomie w dowolnym etapie ligacji, w tym przykładzie istnieje 1/3 szans (zakładając trzech rodziców), że oligonukleotyd z tego samego wariantu macierzystego ulegnie ligacji w sekwencji chimerycznej i nie da crossover. -85- [0268] W związku z tym można określić funkcję gęstości prawdopodobieństwa (PDF) do przewidzenia populacji zdarzeń crossover, które mogą wystąpić podczas każdego etapu w reakcji ligacji biorąc pod uwagę określoną liczbę wariantów macierzystych, liczbę oligonukleotydów odpowiadających każdemu wariantowi i stężenia każdego wariantu w trakcie każdego etapu w reakcji ligacji. Metoda statystyczna i matematyczna leżąca za ustalaniem PDF jest opisana poniżej. Można obliczyć tego rodzaju funkcję gęstości prawdopodobieństwa, a tym samym wzbogacić populację potomstwa chimerycznego dla z góry określonej liczby zdarzeń crossover wynikających z poszczególnych reakcji ligacji. Ponadto, docelową liczbę zdarzeń crossover można określić z góry, a następnie zaprogramować układ, aby obliczyć ilość wyjściową każdego oligonukleotydu macierzystego w każdym etapie reakcji ligacji aby dać funkcję gęstości prawdopodobieństwa, które skupia się na z góry określonej liczby zdarzeń crossover. Określanie Zdarzeń Typu Crossover [0269] Przykłady wykonania według ujawnienia obejmują system i oprogramowanie, które odbierają pożądaną funkcję gęstości prawdopodobieństwa (PDF) dla crossover, liczbę genów macierzystych do ponownego złożenia i liczbę fragmentów podczas procesu ponownego składania jako wartości wejściowe. Wartością wyjściową tego programu jest ?fragment PDF?, który można stosować do określenia przepisu na wytwarzanie ponownie złożonych genów, i szacowanego wystąpienia crossover PDF dla tych genów. Opisane tu przetwarzanie jest korzystnie wykonywane w języku programowania i środowisku programistycznym MATLAB? (Mathworks, Natick, Massachusetts) do obliczeń technicznych. Procesy Iteracyjne [0270] W praktykowaniu ujawnienia te procesy mogą być iteracyjnie powtarzane. Na przykład identyfikuje się i izoluje ponownie jakiś kwas nukleinowy (lub dany kwas nukleinowy) odpowiedzialny za zmieniony fenotyp fosfolipazy, a następnie jest on modyfikowany i testowany raz jeszcze pod kątem aktywności. Ten proces może być iteracyjnie powtarzany do momentu skonstruowania pożądanego fenotypu. Na przykład, cały biochemiczny anaboliczny lub kataboliczny szlak może być konstruowany w komórce, w tym aktywność fosfolipazy. [0271] Podobnie, jeżeli ustali się, że określony oligonukleotyd nie wpływa w żaden sposób na pożądaną cechę (np. nowy fenotyp fosfolipazy), można go usunąć jako zmienną, przez syntetyzowanie większych macierzystych oligonukleotydów, które obejmują sekwencję do usunięcia. Jako że inkorporacja sekwencji w obrębie większej sekwencji zapobiega wszelkim zdarzeniom typu crossover, nie będzie już więcej dowolnej zmienności w odniesieniu do tej sekwencji w potomnych polinukleotydach. Ta iteracyjna praktyka do określania, które oligonukleotydy są w najwyższym stopniu powiązane z pożądaną cechą, i które nie są powiązane, pozwala na bardziej skuteczną eksplorację wszystkich możliwych wariantów białka, które mogłyby zapewnić określoną cechę lub aktywność. Tasowanie in vivo, -86- [0272] Tasowanie cząsteczek in vivo jest stosowane w sposobach według ujawnienia, które zapewniają warianty polipeptydów według wynalazku, np. przeciwciała, enzymy fosfolipazy, i podobne. Tasowanie in vivo można prowadzić wykorzystując naturalną właściwość komórek, do rekombinacji multimerów. Podczas gdy rekombinacja in vivo dostarczyła główną naturalną drogę do różnorodności molekularnej, rekombinacja genetyczna pozostaje względnie złożonym procesem, który wiąże się z 1) rozpoznawaniem homologii; 2) przecinaniem nici, inwazją nici i metabolicznymi etapami prowadzącymi do produkcji rekombinowanych chiazm; i w końcu 3) rozdzieleniem chiazm na odrębne rekombinowane cząsteczki. Wytworzenie się chiazm wymaga rozpoznawania sekwencji homologicznych. [0273] W jednym aspekcie, ujawnienie zapewnia sposób wytwarzania hybrydowego polinukleotydu z co najmniej pierwszego polinukleotydu i drugiego polinukleotydu. Ujawnienie może być stosowane do wytwarzania hybrydowego polinukleotydu przez wprowadzenie co najmniej pierwszego polinukleotydu i drugiego polinukleotydu, które mają wspólny co najmniej jeden region homologii częściowej do odpowiedniej komórki gospodarza. Regiony częściowej homologii sekwencji promują procesy, które mogą doprowadzić do reorganizacji sekwencji wytwarzania hybrydowego polinukleotydu. Określenie ?hybrydowy polinukleotyd?, w stosowanym tu kontekście, to dowolna sekwencja nukleotydowa, która powstaje ze sposobu według niniejszego ujawnienia i zawiera sekwencję z co najmniej dwóch pierwotnych sekwencji polinukleotydowych. Takie hybrydowe polinukleotydy mogą powstawać z międzycząsteczkowych zdarzeń rekombinacji, które promują integrację sekwencji pomiędzy cząsteczkami DNA. Ponadto, takie hybrydowe polinukleotydy mogą powstawać z wewnątrzcząsteczkowych procesów redukcyjnej reasortacji, które wykorzystują powtarzane sekwencje do zmiany sekwencji nukleotydowej w obrębie cząsteczki DNA. Wytwarzanie wariantów sekwencji [0274] Ujawnienie zapewnia również sposoby wytwarzania wariantów sekwencji kwasu nukleinowego i sekwencji fosfolipazy według wynalazku, lub izolowania enzymu fosfolipazy, np. fosfolipazy, wariantów sekwencji przy użyciu kwasów nukleinowych i polipeptydów według wynalazku. W jednym aspekcie, ujawnienie zapewnia warianty genu fosfolipazy według wynalazku, które można zmieniać dowolnymi sposobami, w tym, np. sposobami losowymi lub stochastycznymi, albo niestochastycznymi lub ?ukierunkowanej ewolucji?, jak omówiono powyżej. [0275] Izolowane warianty mogą oznaczać te naturalnie występujące. Wariant można również sporządzić in vitro. Warianty mogą być otrzymywane przy użyciu technik inżynierii genetycznej takich, jak mutageneza ukierunkowana, losowa mutageneza chemiczna, procedury delecji egzonukleazy III i standardowe techniki klonowania. Alternatywnie, takie warianty, fragmenty, analogi lub pochodne można wytwarzać przy użyciu syntezy chemicznej lub procedur modyfikacji. Inne sposoby wytwarzania wariantów są również znane znawcy. Obejmują one procedury, w których sekwencje kwasów nukleinowych uzyskane z naturalnych izolatów są modyfikowane w celu wytworzenia kwasów nukleinowych, które kodują polipeptydy mające cechy, które zwiększają ich wartość w zastosowaniach -87- przemysłowych lub laboratoryjnych. W takich procedurach, wytwarza się i charakteryzuje dużą liczbę wariantów sekwencji z jedną lub większą liczbą różnic nukleotydowych w stosunku do sekwencji uzyskanych z naturalnych izolatów. Te różnice nukleotydów mogą prowadzić do zmian aminokwasowych w odniesieniu do polipeptydów kodowanych przez kwasy nukleinowe z naturalnych izolatów. [0276] Przykładowo, warianty mogą być tworzone za pomocą podatnej na błędy PCR. W podatnej na błędy PCR, PCR przeprowadza się w warunkach, gdzie wierność kopiowania polimerazy DNA jest tak niska, że otrzymuje się wysoki wskaźnik mutacji punktowych na całej długości produktu PCR. Podatna na błędy PCR jest opisana, na przykład, w Leung, D.W., i wsp., Technique, 1:11-15, 1989) i Caldwell, R. C. & Joyce G.F., PCR Methods Applic., 2:28-33, 1992. Krótko mówiąc, w takich procedurach, kwasy nukleinowe do mutagenizowania miesza się ze starterami PCR, buforem reakcyjnym, MgCl2, MnCl2, polimerazą Taq i odpowiednimi stężeniami dNTP dla osiągnięcia wysokiego wskaźnika mutacji punktowych na całej długości produktu PCR. Na przykład, reakcję można przeprowadzić za pomocą 20 fmoli kwasu nukleinowego do mutagenezy, 30 pmola każdego startera PCR, bufora reakcyjnego zawierającego 50mM KCl, 10mM Tris HCl (pH 8.3) i 0,01% żelatyny, 7mM MgCl2, 0,5mM MnCl2, 5 jednostek polimerazy Taq, 0,2mM dGTP, 0,2mM dATP, 1mM dCTP, i 1mM dTTP. PCR można wykonywać przez 30 cykli 94°C przez 1 min, 45°C przez 1 min, i 72°C przez 1 min. Jednakże, należy zauważyć, że te parametry mogą się zmieniać odpowiednio. Mutagenizowane kwasy nukleinowe są klonowane do odpowiedniego wektora i ocenia się aktywności polipeptydów kodowanych przez mutagenizowane kwasy nukleinowe. [0277] Warianty można również otrzymywać przy użyciu mutagenezy kierowanej oligonukleotydami, w celu wygenerowania specyficznych dla miejsca mutacji w dowolnym klonowanym przedmiotowym DNA. Oligonukleotydową mutagenezę opisano np. w Reidhaar-Olson (1988) Science 241: 53-57. Pokrótce, w takich procedurach syntetyzuje się szereg dwuniciowych oligonukleotydów, niosących jedną lub więcej mutacji do wprowadzenia do klonowanego DNA, i wprowadza się je do klonowanego DNA do mutagenizacji. Klony zawierające mutagenizowane DNA odzyskuje się, i ocenia aktywności kodowanych przez nie polipeptydów. [0278] Kolejny sposób generowania wariantów to PCR typu składanie. PCR typu składanie wymaga złożenia produktu PCR z mieszaniny małych fragmentów DNA. W tej samej fiolce dochodzi do dużej liczby różnych równoległych reakcji PCR, przy czym produkty jednej reakcji prowadzą do powstawania produktów kolejnej reakcji. PCR typu składanie jest opisany np. w Patencie US Nr 5,965,408. [0279] Jeszcze kolejny sposób generowania wariantów to mutageneza za pomocą ?seksualnego? PCR. W mutagenezie za pomocą PCR ?seksualnego? dochodzi do wymuszonej homologicznej rekombinacji pomiędzy cząsteczkami DNA różnych, ale wysoce powiązanych sekwencji DNA in Vitro, w wyniku losowej fragmentacji cząsteczki DNA w oparciu o homologię sekwencji, a następnie do utrwalenia zdarzenia crossover przez przedłużenie starterów w reakcji PCR. Mutageneza za pomocą PCR ?seksualnego? jest -88- opisana, np. w Stemmer (1994) Proc. Natl. Acad. Sci. USA 91:10747-10751, Pokrótce, w takich procedurach trawi się szereg kwasów nukleinowych do rekombinacji, za pomocą DNazy, w celu wygenerowania fragmentów mających średni rozmiar 50-200 nukleotydów. Fragmenty o pożądanym średnim rozmiarze są oczyszczane i zawieszane ponownie w mieszaninie PCR. PCR prowadzi się w warunkach, które ułatwiają rekombinację pomiędzy fragmentami kwasu nukleinowego. Na przykład, PCR można prowadzić przez ponowne zawieszenie oczyszczonych fragmentów o stężeniu 10-30 ng/?l w roztworze 0,2 mM każdego dNTP, 2,2 mM MgCl2, 50 mM KCL, 10 mM Tris HCl, pH 9,0, i 0,1% Triton X-100. Dodaje się 2,5 jednostki polimerazy Taq w proporcji 100:1 mieszaniny reakcyjnej, a PCR prowadzi się przy użyciu poniższego schematu: 94°C przez 60 sekund, 94°C przez 30 sekund, 50-55°C przez 30 sekund, 72°C przez 30 sekund (30-45 razy) i 72°C przez 5 minut. Jednakże należy zauważyć, że te parametry można odpowiednio różnicować. W pewnych aspektach, oligonukleotydy mogą być zawarte w reakcjach PCR. W innych aspektach, można stosować fragment Klenowa polimerazy DNA I w pierwszym zestawie reakcji PCR, a polimerazę Taq w późniejszym zestawie reakcji PCR. izoluje się sekwencje rekombinowane i ocenia aktywności kodowanych przez nie polipeptydów. [0280] Warianty można również otrzymywać na drodze mutagenezy in vivo. W niektórych przykładach wykonania generuje się losowe mutacje w przedmiotowej sekwencji, przez propagowanie przedmiotowej sekwencji w szczepie bakteryjnym, takim jak szczep E. coli, który niesie mutacje w jednym lub więcej szlaków naprawy DNA. Takie ?mutatorowe? szczepy mają wyższy wskaźnik występowania losowych mutacji niż ten dla macierzystego typu dzikiego. Propagowanie DNA w jednym z tych szczepów będzie w końcu generować losowe mutacje w obrębie DNA. Mutatorowe szczepy odpowiednie do stosowania w mutagenezie in vivo opisano np. w Publikacji PCT Nr WO 91/16427. [0281] Warianty można również generować przy użyciu mutagenezy kasetowej. W mutagenezie kasetowej niewielki region cząsteczki dwuniciowego DNA jest zastępowany ?kasetą? syntetycznego oligonukleotydu, która różni się od sekwencji natywnej. Oligonukleotyd często zawiera w pełni i/lub częściowo randomizowaną sekwencję natywną. [0282] Można również stosować rekursywną mutagenezę zespołową, w celu wygenerowania wariantów. Rekursywna mutageneza zespołowa oznacza algorytm do konstruowania białka (mutageneza białek) opracowany do celu wytworzenia zróżnicowanych populacji powiązanych fenotypowo mutantów, przy czym elementy [tych populacji] różnią się sekwencją aminokwasową. Ten sposób wykorzystuje mechanizm sprzężenia zwrotnego do kontrolowania kolejnych rund kombinatorycznej mutagenezy kasetowej. Rekursywna mutageneza zespołowa jest opisana np. w Arkin (1992) Proc. Natl. Acad. Sci. USA 89:78117815. [0283] W niektórych przykładach wykonania sporządza się warianty przy użyciu wykładniczej mutagenezy zespołowej. Wykładnicza mutageneza zespołowa oznacza proces do generowania kombinatorycznych bibliotek z wysokim odsetkiem unikatowych i funkcjonalnych mutantów, przy czym niewielkie grupy reszt są równolegle randomizowane, aby zidentyfikować, w każdej zmienionej pozycji, aminokwasy, które prowadzą do -89- funkcjonalnych białek. Wykładnicza mutageneza zespołowa jest opisana np. w Delegrave (1993) Biotechnology Res. 11:1548-1552. Losową i ukierunkowaną mutagenezę opisano np. w Arnold (1993) Current Opinion in Biotechnology 4:450-455. [0284] W niektórych przykładach wykonania warianty są tworzone przy użyciu procedur tasowania, w których porcje szeregu kwasów nukleinowych, które kodują odrębne polipeptydy są łączone ze sobą, dla utworzenia chimerycznych sekwencji kwasu nukleinowego, które kodują polipeptydy chimeryczne, jak opisano np. w Patencie US Nry 5,965,408; US 5,939,250. [0285] Wynalazek zapewnia również warianty polipeptydów według wynalazku zawierające sekwencje, w których jedna lub więcej reszt aminokwasowych (np. przykładowego polipeptydu według wynalazku) są podstawione konserwatywną lub niekonserwatywną resztą aminokwasową (np. konserwatywną resztą aminokwasową) i taka podstawiona reszta aminokwasowa może być, lub nie, kodowana przez kod genetyczny. Konserwatywne substytucje oznaczają te, które podstawiają dany aminokwas w polipeptydzie kolejnym aminokwasem o podobnej charakterystyce. Zatem polipeptydy według wynalazku obejmują te o konserwatywnych substytucjach sekwencji według wynalazku, w tym bez ograniczania do wymienionych poniższe substytucje: zamiana alifatycznego aminokwasu takiego, jak alanina, walina, leucyna i izoleucyna na kolejny alifatyczny aminokwas; zamiana seryny na treoninę lub vice versa; zamiana kwasowej reszty takiej jak kwas asparaginowy i kwas glutaminowy na kolejną kwasową resztę; zamiana reszty niosącej grupę amidową takiej, jak asparagina i glutamina, na kolejną resztę niosącą grupę amidową; wymiana reszty zasadowej takiej, jak lizyna i arginina na kolejną resztę zasadową; i zamiana aromatycznej reszty takiej, jak fenyloalanina, tyrozyna na kolejną aromatyczną resztę. Inne warianty to takie, w których jedna lub więcej reszt aminokwasowych polipeptydów według wynalazku zawiera grupę podstawnika. [0286] Inne warianty w obrębie zakresu ujawnienia to takie, w których polipeptyd jest powiązany z kolejnym związkiem, takim jak związek do wydłużenia okresu półtrwania polipeptydu, na przykład, glikol polietylenowy. [0287] Dodatkowymi wariantami w obrębie zakresu wynalazku są te, w których dodatkowe aminokwasy są sprzęgane z polipeptydem takie, jak sekwencja liderowa, sekwencja wydzielnicza, sekwencja probiałka lub sekwencja, która ułatwia oczyszczanie, wzbogacanie lub stabilizację polipeptydu. [0288] W pewnych aspektach, warianty, fragmenty, pochodne i analogi polipeptydów według ujawnienia zachowują taką samą funkcję biologiczną lub aktywność jak przykładowe polipeptydy, np. aktywność fosfolipazy, jak tu opisanej. W innych aspektach, wariant, fragment, pochodna lub analog obejmuje probiałko, tak, że wariant, fragment, pochodna lub analog może być aktywowany przez przecinanie części probiałka, dla utworzenia aktywnego polipeptydu. Optymalizowanie kodonów dla uzyskania wysokich poziomów ekspresji białka w komórkach gospodarza -90- [0289] Ujawnienie zapewnia sposoby do modyfikowania kodujących fosfolipazę kwasów nukleinowych, w celu modyfikowania wykorzystywania kodonów. W jednym aspekcie, ujawnienie zapewnia sposoby do modyfikowania kodonów w kwasie nukleinowym kodującym fosfolipazę, w celu podwyższenia lub obniżenia jego ekspresji w komórce gospodarza. Ujawnienie zapewnia również kwasy nukleinowe kodujące fosfolipazę modyfikowaną w celu podwyższenia jej ekspresji w komórce gospodarza, enzymy fosfolipazy modyfikowane w ten sposób, i sposoby wytwarzania modyfikowanych enzymów fosfolipazy. Sposób obejmuje identyfikowanie ?niekorzystnego? lub ?mniej korzystnego? kodonu w kodującym fosfolipazę kwasie nukleinowym i zastępowanie jednego lub więcej tych niekorzystnych lub mniej korzystnych kodonów ?korzystnym kodonem? kodującym ten sam aminokwas co zastępowany kodon, i co najmniej jeden niekorzystny lub mniej korzystny kodon w kwasie nukleinowym są zastępowane przez korzystny kodon kodujący ten sam aminokwas. Korzystny kodon oznacza kodon nadreprezentowany w sekwencjach kodujących w genach w komórce gospodarza, a niekorzystny lub mniej korzystny kodon oznacza kodon niedostatecznie reprezentowany w sekwencjach kodujących w genach w komórce gospodarza. [0290] Komórki gospodarza do eksprymowania kwasów nukleinowych, kaset ekspresyjnych i wektorów według wynalazku obejmują bakterie, drożdże, grzyby, komórki roślinne, komórki owadzie i komórki ssacze. Zatem ujawnienie zapewnia sposoby do optymalizowania wykorzystywania kodonów we wszystkich tych komórkach, kwasy nukleinowe ze zmienionymi kodonami i polipeptydy otrzymane z kwasów nukleinowych ze zmienionymi kodonami. Przykładowe komórki gospodarza obejmują bakterie Gram taki, jak Escherichia coli; Gram-dodatnie bakterie takie, jak dowolny Bacillus (np. B. cereus) lub Streptomyces, Lactobacillus gasseri, Lactococcus lactis, Lactococcus cremoris, Bacillus subtilis. Przykładowe komórki gospodarza obejmują również organizmy eukariotyczne, np. różne drożdże takie, jak Saccharomyces sp., w tym Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pichia pastoris i Kluyveromyces lactis, Hansenula polymorpha, Aspergillus niger, i komórki ssacze, linie komórkowe oraz komórki owadzie i linie komórkowe. Zatem ujawnienie obejmuje również kwasy nukleinowe i polipeptydy optymizowane do ekspresji w tych organizmach i gatunkach. [0291] Na przykład, kodony kwasu nukleinowego kodującego fosfolipazę izolowaną z komórki bakteryjnej są modyfikowane tak, że kwas nukleinowy jest optymalnie eksprymowany w komórce bakteryjnej różnej od bakterii, z których pochodzi fosfolipaza, w drożdżach, grzybach, komórce roślinnej, komórce owadziej lub komórce ssaczej. Sposoby do optymalizowania kodonów są dobrze znane ze stanu techniki, patrz np. Patent US Nr 5,795,737; Baca (2000) Int. J. Parasitol. 30:113-118; Hale (1998) Protein Expr. Purif. 12:185188; Narum (2001) Infect. Immun. 69:7250-7253. Patrz również Narum (2001) Infect. Immun. 69: 7250-7253, opisujący optimalizowanie kodonów w mysich systemach; Outchkourov (2002) Protein Expr. Purif. 24:18-24, opisujący optimalizowanie kodonów w drożdżach; Feng (2000) Biochemistry 39:15399-15409, opisujący optimalizowanie kodonów w E. coli; Humphreys (2000) Protein Expr. Purif. 20:252-264, opisujący optimalizowanie wykorzystywania kodonów, który wpływa na wydzielanie w E. coli. -91- Transgeniczne zwierzęta inne niż ludzie [0292] Wynalazek zapewnia transgeniczne inne niż ludzie zwierzęta zawierające kwas nukleinowy, polipeptyd, kasetę ekspresyjną, wektor lub komórkę ? transfekowaną lub transformowaną, według wynalazku. Transgeniczne, inne niż ludzie zwierzęta mogą oznaczać np. kozy, króliki, owce, świnie, krowy, szczury i myszy, zawierające kwasy nukleinowe według wynalazku. Te zwierzęta można stosować, np. jako modele in vivo do badania aktywności fosfolipazy, lub jako modele do poszukiwań przesiewowych modulatorów aktywności fosfolipazy in vivo. Sekwencje kodujące dla polipeptydów do eksprymowania w transgenicznych, różnych od ludzi zwierzętach można projektować jako konstytutywne, lub pozostające pod kontrolą specyficznych tkankowo, specyficznych dla rozwoju lub indukowalnych transkrypcyjnych czynników regulacyjnych. Transgeniczne, inne niż ludzie zwierzęta można projektować i generować przy użyciu dowolnego sposobu znanego ze stanu techniki; patrz np. Patenty US Nry 6,211,428; US 6,187,992; US 6,156,952; US 6,118,044; US 6,111,166; US 6,107,541; US 5,959,171; US 5,922,854; US 5,892,070; US 5,880,327; US 5,891,698; US 5,639,940; US 5,573,933; US 5,387,742; US 5,087,571, opisujące otrzymywanie i stosowanie transformowanych komórek i jaj, oraz transgenicznych myszy, szczurów, królików, owcy, świń i krów. Patrz również, np. Pollock (1999) J. Immunol. Methods 231:147-157, opisujący produkcję rekombinowanych białek w mleku transgenicznych zwierząt dających mleko; Baguisi (1999) Nat. Biotechnol. 17:456-461, wykazujący na produkcję transgenicznych kóz. Patent US Nr 6,211,428, opisuje otrzymywanie i stosowanie transgenicznych, różnych od ludzi ssaków, które eksprymują w swoich mózgach konstrukt kwasu nukleinowego zawierający sekwencję DNA. Patent US Nr 5,387,742 opisuje wstrzykiwanie klonowanych rekombinowanych lub syntetycznych sekwencji DNA do zapłodnionych jaj myszy, implantowanie wstrzykniętych jaj u samic z ciążą rzekomą, i hodowanie do rozwiązania transgenicznych myszy, których komórki eksprymują białka związane z patologią choroby Alzheimera. Patent US Nr 6,187,992, opisuje otrzymywanie i stosowanie transgenicznej myszy, której genom zawiera zakłócenie genu kodującego białko prekursorowe amyloidu (APP). [0293] Można również stosować ?zwierzęta typu knockout? do praktykowania sposobów według wynalazku. Na przykład, w jednym aspekcie, transgeniczne lub modyfikowane zwierzęta według wynalazku obejmują ?zwierzę typu knockout? np. ?mysz typu knockout? konstruowane tak, aby nie eksprymowały lub były niezdolne do ekspresji fosfolipazy. Transgeniczne Rośliny i Nasiona [0294] Wynalazek zapewnia transgeniczne rośliny i nasiona zawierające kwas nukleinowy, polipeptyd (np. fosfolipazę), kasetę ekspresyjną, wektor lub komórkę ? transfekowaną lub transformowaną, według wynalazku. Wynalazek zapewnia również produkty roślinne, np. oleje, nasiona, liście, wyciągi i podobne, zawierające kwas nukleinowy i/lub polipeptyd (np. fosfolipazę) według wynalazku. Transgeniczna roślina może być dwuliścienna (ang. dicot) lub jednoliścienna (ang. monocot). Wynalazek zapewnia również sposoby wytwarzania i stosowania tych transgenicznych roślin i nasion. Transgeniczna roślina lub komórka roślinna -92- eksprymująca polipeptyd według wynalazku może być konstruowana zgodnie z dowolnym sposobem znanym ze stanu techniki. Patrz na przykład Patent US Nr 6,309,872. [0295] Kwasy nukleinowe i konstrukty ekspresyjne według wynalazku można wprowadzać do komórki roślinnej dowolnymi sposobami. Na przykład, kwasy nukleinowe lub konstrukty ekspresyjne można wprowadzać do genomu pożądanej rośliny ? gospodarza, lub kwasy nukleinowe lub konstrukty ekspresyjne mogą oznaczać episomy. Wprowadzenie do genomu pożądanej rośliny może wyglądać tak, że produkcja fosfolipazy gospodarza jest regulowana przez endogenne transkrypcyjne lub translacyjne elementy kontrolne. Ujawnienie zapewnia również ?rośliny typu knockout? w których wprowadzenie sekwencji genu np. przez homologiczną rekombinacje, zakłóciło ekspresję endogennego genu. Sposoby do generowania roślin ?knockout? są dobrze znane ze stanu techniki, patrz np. Strepp (1998) Proc Natl. Acad. Sci. USA 95:4368-4373; Miao (1995) Plant J 7:359-365. Patrz omówienie roślin transgenicznych poniżej. [0296] Kwasy nukleinowe według wynalazku można stosować do nadawania pożądanych cech zasadniczo dowolnej roślinie, np. roślinom o nasionach oleistych takich, jak ryż, nasiona soi, nasiona rzepaku, nasiona słonecznika, sezam i orzeszki arachidowe. Kwasy nukleinowe według wynalazku można stosować do manipulowania szlakami metabolicznymi rośliny, w celu optymalizacji lub zmienienia ekspresji fosfolipazy u gospodarza. Mogą one zmienić aktywność fosfolipazy w roślinie. Alternatywnie, fosfolipazę według wynalazku można stosować w produkcji transgenicznych roślin, do produkcji związku, który nie jest naturalnie produkowany prze tę roślinę. Może to zmniejszyć koszty produkcji lub wygenerować nowy produkt. [0297] W jednym aspekcie, pierwszy etap w produkcji rośliny transgenicznej obejmuje wytwarzanie konstruktu ekspresyjnego do ekspresji w komórce roślinnej. Techniki te są dobrze znane w tej dziedzinie techniki. Mogą one obejmować wybranie i klonowanie promotora, sekwencji kodującej dla ułatwienia skutecznego wiązania rybosomów mRNA i wybieranie odpowiedniej sekwencji terminatora genu. Przykładowym promotorem konstytutywnym jest CaMV35S, z wirusa mozaiki kalafiora, który z reguły prowadzi do wysokiego stopnia ekspresji w roślinach. Inne promotory są bardziej specyficzne i odpowiadają na sygnały w środowisku wewnętrznym lub zewnętrznym rośliny. Przykładowym indukowanym światłem promotorem jest promotor genu kabiny, kodujący główne białko wiążące chlorofil a/b. [0298] Kwas nukleinowy może być zmodyfikowany tak, aby osiągnąć większą ekspresję w komórce roślinnej. Na przykład, sekwencja według wynalazku może mieć wyższy odsetek par nukleotydów A-T w stosunku do obserwowanego w roślinie, z których niektóre preferują pary nukleotydów G-C. Dlatego, nukleotydy A-T w sekwencji kodującej mogą być podstawione nukleotydami G-C bez znaczącej zmiany sekwencji aminokwasowej w celu zwiększenia wytwarzania produktu genu w komórkach roślinnych. [0299] Można dodawać gen marker podlegający selekcji do konstruktu genowego, w celu identyfikowania komórek roślinnych lub tkanek, które mają poprawnie zintegrowany -93- transgen. Może to być konieczne, ponieważ osiągnięcie inkorporacji i ekspresji genów w komórkach roślinnych jest zdarzeniem rzadkim, zachodzącym jedynie w kilku procentach docelowych tkanek lub komórek. Geny markerów selekcyjnych kodują białka, które zapewniają oporność na środki, które są normalnie toksyczne dla rośliny takie, jak antybiotyki lub herbicydy. Jedynie komórki roślinne, które mają zintegrowany gen markera podlegającego selekcji przetrwają, gdy będą hodowane na pożywce zawierającej odpowiedni antybiotyk lub herbicyd. Co do innych wprowadzanych genów, geny markerowe wymagają również sekwencji promotora i terminacji dla prawidłowego funkcjonowania. [0300] Wytwarzanie transgenicznych roślin lub nasion obejmuje inkorporowanie sekwencji według ujawnienia oraz, opcjonalnie, genów markerowych do docelowego konstruktu ekspresyjnego (np. plazmidu), wraz z pozycjonowaniem sekwencji promotora i terminacji. Może to oznaczać przeniesienie modyfikowanego genu do rośliny w odpowiedni sposób. Na przykład, konstrukt można wprowadzać bezpośrednio do genomowego DNA komórki roślinnej przy użyciu technik takich jak elektroporacja i mikrowstrzykiwanie do protoplastów komórki roślinnej, lub można wprowadzać konstrukty bezpośrednio do tkanki roślinnej przy użyciu sposobów balistycznych takich, jak bombardowanie cząstkami pokrytymi DNA. Na przykład, patrz np. Christou (1997) Plant Mol. Biol. 35:197-203; Pawlowski (1996) Mol. Biotechnol. 6:17-30; Klein (1987) Nature 327:70-73; Takumi (1997) Genes Genet. Syst. 72:63-69, omawiające stosowanie bombardowania cząstkami do wprowadzania transgenów do pszenicy; i Adam (1997) supra, odnośnie stosowania bombardowania cząstkami do wprowadzania YAC-ów do komórek roślinnych. Na przykład, Rinehart (1997) supra, stosował bombardowanie cząstkami w celu wygenerowania transgenicznych roślin bawełny. Urządzenie do przyspieszania cząstek jest opisane w Patencie US Nr 5,015,580; oraz, dostępne w handlu urządzenie BioRad (Biolistics) PDS-2000 do przyspieszania cząstek; patrz również, John, Patent US Nr 5,608,148; i Ellis, Patent US Nr 5, 681,730, opisujący regulowaną cząstkami transformację roślin nagonasiennych. [0301] Protoplasty można unieruchomić i wstrzykiwać z kwasami nukleinowymi, np. konstruktem ekspresyjnym. Chociaż regeneracja roślin z protoplastów nie jest łatwa w przypadku zbóż, regeneracja roślin motylkowych jest możliwa za pomocą somatycznej embriogenezy z kalusa pochodzącego z protoplastów. Zorganizowane tkanki mogą być przekształcone nagim DNA techniką strzelby genowej, w której DNA powleka się na mikropociskach wolframu, strzela 1/100 wielkości komórek, które niosą DNA głęboko do komórek i organelli. Transformowana tkanka jest następnie indukowana do regeneracji, zazwyczaj poprzez somatyczną embriogenezę. Technikę tę z powodzeniem stosowano w wielu gatunkach, w tym zbóż i kukurydzy, ryżu. [0302] Kwasy nukleinowe, np. konstrukty ekspresyjne, można również wprowadzać do komórek roślinnych przy użyciu rekombinowanych wirusów. Komórki roślinne można transformować przy użyciu wektorów wirusowych takich, jak, np. wektory na bazie wirusa mozaiki tytoniu (Rouwendal (1997) Plant Mol. Biol. 33:989-999), patrz Porta (1996) ?Use of viral replicons for the expression of genes in plants?, Mol. Biotechnol. 5:209-221. -94- [0303] Alternatywnie, kwasy nukleinowe np. konstrukt ekspresyjny, mogą być łączone z odpowiednimi regionami flankującymi T-DNA i wprowadzane do konwencjonalnych wektorów gospodarza Agrobacterium tumefaciens. Funkcje wirulencji gospodarza Agrobacterium tumefaciens kierują wprowadzenie konstruktu i przyległego markera do DNA komórki roślinnej, gdy komórka zostanie zakażona bakteriami. Techniki transformacji za pośrednictwem Agrobacterium tumefaciens, w tym rozbrajanie i zastosowanie wektorów binarnych, są dobrze opisane w literaturze naukowej. Patrz, np. Horsch (1984) Science 233:496-498; Fraley (1983) Proc. Natl. Acad. Sci. USA 80:4803 (1983); Gene Transfer to Plants, Potrykus, ed. (Springer-Verlag, Berlin 1995). DNA w komórce A. tumefaciens znajduje się w chromosomie bakteryjnym, a także w znanej strukturze znanej jako plazmid (indukujący nowotwory) Ti. Plazmid Ti zawiera odcinek DNA nazywany T-DNA (o długości ?20 kb), który jest przenoszony do komórki roślinnej w procesie infekcji oraz serie genów vir (wirulencji), które kierują procesem infekcji. A. tumefaciens może tylko zarażać poprzez rany roślin: gdy korzeń lub łodyga rośliny jest zraniona wydziela pewne sygnały chemiczne, w odpowiedzi na które, geny vir A. tumefaciens stają się aktywne i kierują serię zdarzeń niezbędnych dla przenoszenia T-DNA z plazmidu Ti do chromosomu rośliny. T-DNA, a następnie wchodzi do komórki roślinnej przez ranę. Jedna hipoteza zakłada, ze T-DNA czeka aż roślinne DNA jest replikowane lub transkrybowane, a następnie wstawia się do eksponowanego DNA roślinnego. W celu wykorzystania A. tumefaciens jako wektor transgenu, należy usunąć sekcję indukującą nowotwory T-DNA, zachowując regiony graniczne T-DNA i geny vir. Transgen następnie wstawia się pomiędzy regionami przygranicznymi T-DNA, gdzie przenosi się do komórki roślinnej i zostaje włączony do chromosomów tej rośliny. [0304] Ujawnienie zapewnia transformację roślin jednoliściennych, przy użyciu kwasów nukleinowych według wynalazku, w tym ważnych zbóż, patrz Hiei (1997) Plant Mol. Biol. 35:205-218. Patrz również, np. Horsch, Science (1984) 233:496; Fraley (1983) Proc. Natl. Acad. Sci USA 80:4803; Thykjaer (1997) supra; Park (1996) Plant Mol. Biol. 32:1135-1148, omawiające integrację T-DNA do genomowego DNA. Patrz również D'Halluin, Patent US Nr 5,712,135, opisujący proces do stabilnej integracji DNA zawierającego gen, który jest funkcjonalny w komórce zbóż, lub innej rośliny jednoliściennej. [0305] Trzeci etap może wymagać selekcji i regeneracji całych roślin, zdolnych do przenoszenia włączonego docelowego genu do następnej generacji. Takie techniki regeneracji opierają się na operacji pewnymi fitohormonami w pożywce wzrostowej do hodowli tkankowej, typowo bazują na markerach - biocydach i/lub herbicydach, które zostały wprowadzone wraz z pożądanymi sekwencjami nukleotydowymi. Regenerację rośliny z hodowanych protoplastów opisano w Evans i wsp., Protoplasts Isolation and Culture, Handbook of Plant Cell Culture, str. 124-176, MacMillilan Publishing Company, New York, 1983; i Binding, Regeneration of Plants, Plant Protoplasts, str. 21-73, CRC Press, Boca Raton, 1985. Regenerację można również osiągnąć za pośrednictwem roślinnego kalusa, eksplantatów, organów lub ich części. Takie techniki regeneracji opisano ogólnie w Klee (1987) Ann. Rev. of Plant Phys. 38:467-486. Aby otrzymać kompletne rośliny z transgenicznych tkanek takich, jak niedojrzałe zarodki, można je hodować w kontrolowanych -95- warunkach środowiska w szeregu pożywek zawierających składniki odżywcze i hormony, proces znany jako hodowla tkankowa. Po regeneracji całych roślin i otrzymaniu nasion rozpoczyna się ocena potomstwa. [0306] Po stabilnej inkorporacji kasety ekspresyjnej w transgenicznych roślinach, można ją wprowadzać do innych roślin przez krzyżowanie na drodze płciowej. Można stosować dowolną liczbę standardowych technik hodowlanych, zależnie od gatunku, który ma posłużyć do krzyżowania. Jako że transgeniczna ekspresja kwasów nukleinowych według wynalazku prowadzi do zmian fenotypowych, rośliny zawierające rekombinowane kwasy nukleinowe według wynalazku można krzyżować płciowo z drugą rośliną, do otrzymania końcowego produktu. Zatem nasiono według wynalazku może pochodzić ze skrzyżowania dwóch transgenicznych roślin według wynalazku, lub ze skrzyżowania rośliny według wynalazku i kolejnej rośliny. Pożądane efekty (np. ekspresja polipeptydów według wynalazku, do wytworzenia rośliny, w której zmieniono zachowania powiązane z kwitnieniem) mogą nasilić się, gdy obie rośliny macierzyste eksprymują polipeptydy (np. fosfolipazę) według wynalazku. Pożądane efekty mogą zostać przeniesione do kolejnych pokoleń roślin za pomocą standardowych sposobów propagacji. [0307] Kwasy nukleinowe i polipeptydy według wynalazku są eksprymowane w lub wprowadzane do dowolnej rośliny lub nasienia. Transgeniczne rośliny według wynalazku mogą być dwuliścienne lub jednoliścienne. Przykładami jednoliściennych roślin transgenicznych według wynalazku są trawy takie, jak wiechlina (wyklina, trawa Poa), trawa pastewna taka, jak kostrzewa, życica, trawy klimatu umiarkowanego takie, jak Agrostis, i zboża, np. pszenica, owies, żyto, jęczmień, ryż, sorgo i kukurydza. Przykładami dwuliściennych roślin transgenicznych według wynalazku są tytoń, rośliny strączkowe takie, jak łubiny, ziemniak, burak cukrowy, groszek, fasola i soja, i rośliny kapustne (rodzina Brassicaceae) takie, jak kalafior, rzepak, i blisko spokrewniony organizm modelowy Arabidopsis thaliana. Zatem transgeniczne rośliny i nasiona według wynalazku obejmują szeroki zakres roślin, w tym, w sposób nieograniczający, gatunki z rodzaju Anacardium, Arachis, Asparagus, Atropa, Avena, Brassica, Citrus, Citrullus, Capsicum, Carthamus, Cocos, Coffea, Cucumis, Cucurbita, Daucus, Elaeis, Fragaria, Glycine, Gossypium, Helianzatem Heterocallis, Hordeum, Hyoscyamus, Lactuca, Linum, Lolium, Lupinus, Lycopersicon, Malus, Manihot, Majorana, Medicago, Nicotiana, Olea, Oryza, Panium, Pannisetum, Persia, Phaseolus, Pistachia, Pisum, Pyrus, Prunes, Raphanus, Ricinus, Secale, Senecio, Sinapis, Solanum, Sorghum, Theobromus, Trigonella, Triticum, Vicia, Vitis, Vigna i Zea. [0308] W alternatywnych przykładach wykonania kwasy nukleinowe według wynalazku są eksprymowane w roślinach (np. jako transgeniczne rośliny) takich, jak rośliny o nasionach oleistych, np. ryż, nasiona soi, nasiona rzepaku, nasiona słonecznika, sezam i orzeszki arachidowe. Kwasy nukleinowe według wynalazku można eksprymować w roślinach, które zawierają komórki włókien, w tym, np. bawełna, puchowiec pięciopręcikowy (drzewo kapokowe, Ceiba pentandra), wierzba pustynna, krzew kreozotowy, Krascheninnikovia, balsa, ramia, ketmia konopiowata, konopie, ketmia szczawiowa, juta, agawa, abaka i len. W -96- alternatywnych przykładach wykonania, transgeniczne rośliny według wynalazku mogą należeć do rodzaju Gossypium, w tym do dowolnego gatunku Gossypium takiego, jak G. arboreum, G. herbaceum, G. barbadense i G. hirsutum. [0309] Ujawnienie zapewnia również transgeniczne rośliny do stosowana do wytwarzania dużych ilości polipeptydów (np. fosfolipaza lub przeciwciało) według wynalazku. Na przykład, patrz Palmgren (1997) Trends Genet. 13:348; Chong (1997) Transgenic Res. 6:289296 (wytwarzanie białka ludzkiego mleka beta-kazeiny, w transgenicznych roślinach ziemniaka przy użyciu indukowalnego auksyną, dwukierunkowego promotora syntazy mannopiny (mas1',2') ze sposobami transformacji dysków liściowych za pomocą Agrobacterium tumefaciens). [0310] Przy użyciu znanych procedur znawca może badać przesiewowo rośliny według wynalazku poprzez wykrywanie wzrostu lub spadku poziomu mRNA transgenu lub białka w roślinach transgenicznych. Sposoby do wykrywania i określania ilościowego poziomu mRNA lub białka są dobrze znane ze stanu techniki. Polipeptydy i peptydy [0311] Ujawnienie zapewnia wyizolowane lub rekombinowane polipeptydy mające identyczność sekwencji (np. co najmniej 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej, lub całkowitą (100%) identyczność sekwencji) do przykładowej sekwencji według ujawnienia, np. SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:74, SEQ ID NO:76, SEQ ID NO:78, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, SEQ ID NO:92, SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:102, SEQ ID NO:104, SEQ ID NO:106, SEQ ID NO:108 SEQ ID NO:110, SEQ ID NO:112, SEQ ID NO:114, SEQ ID NO:116, SEQ ID NO:118, SEQ ID NO:120, SEQ ID NO:122, SEQ ID NO:124, SEQ ID NO:126, SEQ ID NO:128, SEQ ID NO:130, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:136, SEQ ID NO:138; SEQ ID NO:140; SEQ ID NO:142; SEQ ID NO:144; NO:146, SEQ ID NO:148, SEQ ID NO:150, SEQ ID NO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ ID NO:168, SEQ ID NO:170, SEQ ID NO:172, lub SEQ ID NO:174. Jak omówiono powyżej, identyczność może dotyczyć pełnej długości polipeptydu lub, identyczność może dotyczyć jego podsekwencji, np. regionu co najmniej około 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700 lub więcej reszt. Polipeptydy według ujawnienia mogą być również krótsze niż pełna długość -97- przykładowych polipeptydów (np. SEQ ID NO:2; SEQ ID NO:4; SEQ ID NO:6; SEQ ID NO:8, itd.). W alternatywnym przykładzie wykonania wynalazek zapewnia polipeptydy (peptydy, fragmenty) o rozmiarach od około 5 do pełnej długości polipeptydu, np. enzym taki, jak fosfolipaza, np. fosfolipaza; ma przykładowe rozmiary od około 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 100, 125, 150, 175, 200, 250, 300, 350, 400 lub więcej reszt, np. ciągłych reszt przykładowych fosfolipaz z SEQ ID NO:2; SEQ ID NO:4; SEQ ID NO:6; SEQ ID NO:8, itd. Peptydy według wynalazku mogą być użyteczne jako, np. sondy do znakowania, antygeny, tolerageny, motywy, miejsca aktywne fosfolipazy, domeny wiążące, domeny regulatorowe i podobne. [0312] W jednym aspekcie, polipeptyd ma aktywność fosfolipazy, np. przecinanie glicerolofosforanowego wiązania estrowego, zdolność do hydrolizowania wiązań estru fosforanowego, w tym aktywność patatyny, hydrolazy acylolipidów (LAH), fosfolipazy A, B, C i/lub aktywność fosfolipazy D, lub dowolne ich kombinacje. [0313] W alternatywnych aspektach, przykładowe polipeptydy według wynalazku mają aktywność fosfolipazy, lokalizację sekwencji sygnałowej, i wyjściowe źródło, jak podano w poniższej Tabeli 1, poniżej. Jako pomoc w odczytywaniu tabeli, na przykład, w pierwszym rzędzie, gdzie SEQ ID NO: 143, 144, oznacza polipeptyd mający sekwencję jak podano w SEQ ID NO:144, i kodowany przez, np. SEQ ID NO:143, mający specyficzną dla PLA aktywność PLA, wyjściowo izolowany z nieznanego źródła; kolejny przykład w rzędzie SEQ ID NO:167, 168, gdzie 167, 168 oznacza polipeptyd mający sekwencję jak podano w SEQ ID NO:168, i kodowany przez, np. SEQ ID NO:167, mający aktywność fosfatazy kwasu fosfatydowego, sekwencja sygnałowa to reszty 1 do 30 (?AA1-30? oznacza reszty aminokwasowe 1 do 30 itd.), tj. MARSWKWRPLLSSFLLVSLAPFSTSVPCFK, i wyjściowo izolowany z nieznanego źródła. Wynalazek zapewnia również peptydy zawierające sekwencje sygnałowe, i polipeptydy chimeryczne, gdzie peptydy lub peptydy chimeryczne zawierają sekwencje sygnałowe jak podano w Tabeli 1, i jak opisano poniżej. Tabela 1 Lokalizacj a sekw. sygnałowe j SEQ ID NO: Typ enzymu (AA = aminokwa s) Sygnał (AA) Źródło -98- 143, 144 PLA specyficzne dla PA Nieznane 25, 26 Patatyna Nieznane 77, 78 Patatyna Nieznane 35, 36 Patatyna Nieznane 125, 126 Patatyna Nieznane 135, 136 Patatyna Nieznane 99, 100 Patatyna Nieznane 65, 66 Patatyna Nieznane 87, 88 Patatyna Nieznane 86, 87 Patatyna 45, 46 Patatyna Nieznane 59, 60 Patatyna Nieznane 13, 14 Patatyna Nieznane 71, 72 Patatyna Nieznane 55, 56 Patatyna Nieznane 33, 34 Patatyna Nieznane 91, 92 Patatyna Nieznane 103, 104 Patatyna Nieznane 11, 12 Patatyna Nieznane 17, 18 Patatyna Nieznane 95, 96 Patatyna Nieznane 43, 44 Patatyna Nieznane 27, 28 Patatyna Nieznane 131, 132 Patatyna Nieznane 127, 128 Patatyna Nieznane -99- 133, 134 Patatyna Nieznane 137, 138 Patatyna Nieznane 165, 166 Patatyna Nieznane 167, 168 Kwas fosfatydowy fosfatazy 169, 170 Kwas fosfatydowy fosfatazy Nieznane 171, 172 Kwas fosfatydowy fosfatazy Nieznane 173, 174 Kwas fosfatydowy fosfatazy Nieznane 111, 112 Fosfatydyloinozytol PLC AA1-16 MGAGAILLTGAPTASA Bakterie 107, 108 Fosfatydyloinozytol PLC AA1-23 MSNKKFILKLFICSTILSTFVFA Nieznane 109, 110 Fosfatydyloinozytol PLC AA1-23 MSNKKFILKLFICSTILSTFVFA Nieznane 113, 114 Fosfatydyloinozytol PLC AA1-23 MSNKKFILKLFICSTILSTFVFA Nieznane 117, 118 Fosfatydyloinozytol PLC AA1-23 MNNKKFILKLFICSMVLSAFVFA Nieznane 119, 120 Fosfatydyloinozytol PLC AA1-23 MNNKKFILKLFICSMVLSAFVFA Nieznane 115, 116 Fosfatydyloinozytol PLC AA1-23 MNNKKFILKLFICSMVLSAFVFA Nieznane 121, 122 Fosfatydyloinozytol PLC AA1-23 MRNKKFILKLLICSTVLSTFVFA Nieznane 141, 142 Fosfolipaza MRTTTTNWRQIVKSLKLFLMGLCLF ISASFAS S Nieznane AA1-30 MARSWKWRPLLSSFLLVSLAPFSTS VPCFK Nieznane -100- 155, 156 Fosfolipaza AA1-36 AYA Nieznane 159, 160 Fosfolipaza Nieznane 145, 146 PLA Nieznane 147, 148 PLA Nieznane 149, 150 PLA Nieznane 151, 152 PLA Nieznane 153, 154 PLA Nieznane 157, 158 PLA Nieznane 163, 164 PLA Nieznane 101, 102 PLC AA1-39 LSLVASLRRAPGAALALALAAATLA VTAQGAT AAPAAAAA Bakterie 1, 2 PLC AA1-24 MKKKVLALAAMVALAAPVQSVVF AQ Nieznane 3, 4 PLC AA1-24 MKRKILAIASVIALTAPIQSVAFAH Nieznane 5, 6 PLC AA1-24 MKRKILAIASVIALTAPIQSVAFAH Nieznane 97, 98 PLC AA1-25 MKRKLCTWALVTAIASSTAVIPTAA E Nieznane 7, 8 PLC AA1-29 MITLIKKCLLVLTMTLLLGVFVPLQP SHAT Nieznane 31, 32 PLC AA1-20 MKKKLCTWALVTAISSGVVAI Nieznane 81, 82 PLC AA1-25 MKKKLCTMALVTAISSGVVTIPTEA Q Nieznane 93, 94 PLC AA1-29 MITLIKKCLLVLTMTLLSGVFVPLQP SYAT Nieznane 89, 90 PLC AA1-25 MKKKLCTLAFVTAISSIAITIPTEAQ Nieznane 123, PLC AA1-24 MKKKVLALAAMVALAAPVQSVVF Nieznane -101- 124 A 129, 130 PLC AA1-27 MKKKICTLALVSAITSGVVTIPTVAS A Nieznane 139, 140 PLC AA1-20 MKIKPLTFSFGLAVTSSVQA Nieznane 105, 106 PLC AA1-30 MNRCRNSLNLQLRAVTVAALVVVA SSAALAW Nieznane 9, 10 PLC AA1-20 MKLLRVFVCVFALLSAHSKAD Nieznane 47, 48 PLD Nieznane 15, 16 PLD Nieznane 41, 42 PLD Nieznane 23, 24 PLD Nieznane 51, 52 PLD Nieznane 53, 54 PLD Nieznane 19, 20 PLD 75, 76 PLD Nieznane 57, 58 PLD Nieznane 63, 64 PLD AA1-18 MKNTLILAGCILAAPAVAD Nieznane 79, 80 PLD AA1-23 MRNFSKGLTSILLSIATSTSAMAF Nieznane 37, 38 PLD AA1-23 MRNFSKGLTSILLSIATSTSAMAF Nieznane 61, 62 PLD AA1-21 MTLKLSLLIASLSAVSPAVLAN Nieznane 67, 68 PLD Brak Nieznane 83, 84 PLD AA1-21 MKKIVIYSFVAGVMTSGGVFAA Nieznane 49, 50 PLD AA1-23 MNFWSFLLSITLPMGVGVAHAQPD Nieznane 39, 40 PLD Nieznane 73, 74 PLD Nieznane 29, 30 PLD Nieznane 21, 22 PLD 71, 72 PLD 161, 162 PLD AA1-19 AA1-28 MKKTTLVLALLMPFGAASAQ MQQHKLRNFNKGLTGVVLSVLTSTS AMAF Nieznane Nieznane Nieznane AA1-24 MNRKLLSLCLGATSCIALSLPVHA Nieznane -102- [0314] W jednym aspekcie, ujawnienie zapewnia polipeptydy mające sekwencje jak podano w SEQ ID NO:107 SEQ ID NO:109 SEQ ID NO:111, SEQ ID NO:113, SEQ ID NO:115, SEQ ID NO:117, SEQ ID NO:119, SEQ ID NO:121, SEQ ID NO:123, SEQ ID NO:125, SEQ ID NO:127, SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ ID NO:135, SEQ ID NO:137, SEQ ID NO:139, SEQ ID NO:141, SEQ ID NO:143, SEQ ID NO:145, SEQ ID NO:147, SEQ ID NO:149, SEQ ID NO:151, SEQ ID NO:153, SEQ ID NO:155, SEQ ID NO:157, SEQ ID NO:159, SEQ ID NO:161, SEQ ID NO:163, SEQ ID NO:165, SEQ ID NO:167, SEQ ID NO:169, SEQ ID NO:171 i/lub SEQ ID NO:173, i ich podsekwencje, np. ich miejsca aktywne (?domeny katalityczne?) mające aktywność fosfolipazy, np. aktywność fosfolipazy C (PLC). W jednym aspekcie polipeptyd ma aktywność fosfolipazy, ale jest pozbawiony aktywności hydrolizy obojętnego oleju (trójglicerydu). Na przykład, w jednym aspekcie, polipeptyd ma aktywność fosfolipazy, ale jest pozbawiony jakiejkolwiek aktywności, która oddziałuje na frakcję obojętnego oleju (trójglicerydu). W jednym aspekcie, wynalazek zapewnia sposób odśluzowywania obejmujący stosowanie polipeptydu według wynalazku, mającego aktywność fosfolipazy, ale nie aktywność lipazy. [0315] Polipeptydy i peptydy według wynalazku można izolować z naturalnych źródeł, mogą być syntetyczne, lub stanowić polipeptydy otrzymywane na drodze rekombinacji. Peptydy i białka mogą być rekombinacyjnie eksprymowane in vitro lub in vivo. Peptydy i polipeptydy według wynalazku można otrzymywać i izolować przy użyciu dowolnego sposobu znanego ze stanu techniki. Polipeptyd i peptydy według wynalazku można również syntetyzować, w całości lub części, przy użyciu sposobów chemicznych, dobrze znanych ze stanu techniki. Patrz np. Caruthers (1980) Nucleic Acids Res. Symp. Ser. 215-223; Horn (1980) Nucleic Acids Res. Symp. Ser. 225-232; Banga, A.K., Therapeutic Peptides and Proteins, Formulation, Processing and Delivery Systems (1995) Technomic Publishing Co., Lancaster, PA. Na przykład, syntezę peptydów można prowadzić przy użyciu różnych technik prowadzonych w fazie stałej (patrz np. Roberge (1995) Science 269:202; Merrifield (1997) Methods Enzymol. 289:3-13), a zautomatyzowaną syntezę można osiągnąć np. przy użyciu syntetyzera peptydów ABI 431A (Perkin Elmer) zgodnie z instrukcjami dostarczonymi przez producenta. [0316] Peptydy i polipeptydy według wynalazku mogą być również glikozylowane. Glikozylację można dodawać potranslacyjnie, chemicznie lub za pomocą komórkowych mechanizmów biosyntezy, przy czym to ostatnie wiąże się ze stosowaniem znanych motywów glikozylacji, które mogą być natywne dla sekwencji, lub można ją dodawać jako peptyd lub dodawać do sekwencji kodującej kwasu nukleinowego. Glikozylacja może być Oglikozylacją lub N-glikozylacją. [0317] Peptydy i polipeptydy według ujawnienia, jak zdefiniowane powyżej, obejmują wszystkie postacie ?mimetyku? i ?peptydomimetyku?. Określenia ?mimetyk? i ?peptydomimetyk? odnoszą się do syntetycznego związku chemicznego, który ma zasadniczo te same cechy strukturalne i/lub funkcjonalne polipeptydów według wynalazku. Mimetyk może być albo całkowicie zbudowany z syntetycznych, nie-naturalnych analogów aminokwasów, albo, jest chimeryczną cząsteczką częściowo naturalnych aminokwasów -103- peptydowych i częściowo nienaturalnych analogów aminokwasów. Mimetyk może również zawierać dowolną ilość konserwatywnych podstawień naturalnego aminokwasu, o ile takie podstawienia także zasadniczo nie zmieniają struktury i/lub aktywności mimetyku. Podobnie jak w przypadku polipeptydów według wynalazku, które są wariantami konserwatywnymi, rutynowe doświadczenie ustali, czy mimetyk mieści się w zakresie wynalazku, tj. czy jego struktura i/lub funkcja nie jest znacząco zmieniona. Zatem, w jednym aspekcie, kompozycja mimetyczna mieści się w zakresie ujawnienia, jeśli ma aktywność fosfolipazy. [0318] Polipeptydowe kompozycje mimetyczne według wynalazku mogą zawierać dowolną kombinację nienaturalnych składników strukturalnych. W alternatywnym wariancie, kompozycje mimetyczne według ujawnienia obejmują jedną lub wszystkie z następujących trzech grup strukturalnych: a) grupy łączące reszty inne niż naturalne połączenia wiązaniem amidowym (?wiązanie peptydowe?); b) nienaturalne reszty w miejsce naturalnie występujących reszt aminokwasowych; lub c) reszty, które wywołują drugorzędową mimikę strukturalną, tj. indukują lub stabilizują strukturę drugorzędową, np. konformację beta skrętu, gamma skrętu, beta arkusza, alfa helisy i podobne. Na przykład, polipeptyd według ujawnienia można charakteryzować jako mimetyk, gdy wszystkie lub niektóre z jego reszt są połączone chemicznymi środkami innymi niż naturalne wiązania peptydowe. Poszczególne reszty peptydomimetyków mogą być połączone przez wiązania peptydowe, inne wiązania chemiczne lub środki sprzęgające takie, jak np. aldehyd glutarowy, estry N-hydroksysukcynoimidu, bifunkcyjne maleimidy, N,N'dicykloheksylokarbodiimid (DCC) lub N,N'-diizopropylokarbodiimid (DIC). Grupy łączące, które mogą być alternatywą dla tradycyjnego łączenia wiązaniem amidowym (?wiązania peptydowego?) obejmują, np. ketometylen (np. -C(=O)-CH2- zamiast C(=O)-NH-), aminometylen (CH2-NH), etylen, olefinę (CH=CH), eter (CH2-O), tioeter (CH2-S), tetrazol (CN4-), tiazol, retroamid, tioamid lub ester (patrz, np. Spatola (1983) w Chemistry and Biochemistry of Amino Acids, Peptides and Proteins, Vol. 7, str. 267-357, ?Peptide Backbone Modifications,? Marcell Dekker, NY). [0319] Polipeptyd według ujawnienia można również określić jako mimetyk przez zawartość wszystkich lub części nienaturalnych reszt w miejsce naturalnie występujących reszt aminokwasowych. Reszty nienaturalne są dobrze opisane w literaturze naukowej i patentowej; Kilka przykładowych kompozycji nienaturalnych użytecznych jako mimetyki naturalnych reszt aminokwasowych i wytyczne zostały opisane poniżej. Mimetyki aminokwasów aromatycznych można generować przez zastąpienie przez, np. D- lub Lnafyloalaninę; D- lub L- fenyloglicynę; D- lub L-2 tienyloalaninę; D- lub L-1, -2, 3- lub 4pireneiloalaninę; D- lub L-3 tienyloalaninę; D- lub L-(2-pirydynylo)-alaninę; D- lub L-(3pirydynylo)-alaninę; D- lub L-(2-pirazynylo)-alaninę; D- lub L-(4-izopropylo)-fenyloglicynę; D-(trifluorometylo)-fenyloglicynę; D-(trifluorometylo)-fenyloalaninę; D-p-fluorofenyloalaninę; D- lub L-p-bifenylo-fenyloalaninę; K- lub L-p-metoksy-bifenylofenyloalaninę; D- lub L-2-indolo(alkilo)alaniny; i, D- lub L-alkiloaininy, gdzie alkil może być podstawionym lub niepodstawionym metylem, etylem, propylem, heksylem, butylem, -104- pentylem, izopropyem, izo-butylem, sec-isotylem, izo-pentylem, lub aminokwasami niekwasowymi. Aromatyczne pierścienie nienaturalnego aminokwasu obejmują, np. pierścienie aromatyczne tiazolil, tiofenyl, pirazolil, benzimidazolil, naftyl, furanyl, pirolil i pirydyl. [0320] Mimetyki aminokwasów kwasowych mogą być wytwarzane przez podstawienie, np. niekarboksylowymi aminokwasami przy zachowaniu ładunku ujemnego; (fosfono)alanina; siarczanowana treonina. Boczne grupy karboksylowe (np. aspartylu lub glutamylu) mogą być selektywnie modyfikowane przez reakcję z karbodiimidami (R'-N-C-N-R') jak np. 1cykloheksylo-3(2-morfolinylo-(4-etylo) karbodiimid lub 1-etylo-3(4-azonia-4,4dimetolpentylo)karbodiimid. Aspartyl lub glutamyl mogą również być przekształcone w reszty asparaginylowe i glutaminylowe w reakcji z jonami amoniowymi. Mimetyki aminokwasów zasadowych mogą być wytwarzane przez podstawienie np. (obok lizyny i argininy) aminokwasów ornityny, cytruliny lub kwasu (guanidyno)octowego, kwasu (guanidyno)alkilo-octowego, przy czym alkil jest zdefiniowany powyżej. Pochodne nitrylowe (np. zawierające ugrupowanie CN w miejsce COOH) można być podstawić za asparaginę i glutaminę. Reszty asparaginylowe i glutaminylowe można deaminować do odpowiadających im reszt glutamylu i aspartylu. Mimetyki reszt argininy można wytwarzać przez reakcję z arginylem, np. jednym lub większą liczbą konwencjonalnych odczynników, w tym, np. fenyloglioksal, 2,3-butanodion, 1,2-cykloheksanodion lub ninhydryna, korzystnie w warunkach zasadowych. Mimetyki reszt tyrozynowych można wytworzyć przez reakcję tyrozylu z, na przykład aromatycznymi związkami dwuazoniowymi lub tetranitrometanem. N-acetyloimidizol i tetranitrometan można stosować do wytwarzania odpowiednio form Oacetylo tyrozylowych i pochodnych 3-nitro. Mimetyki reszt cysteiny mogą być wytwarzane przez reakcję reszt cysteinowych z, np. alfa-halogenooctanami takimi, jak kwas 2chlorooctowy lub chloroacetamid oraz odpowiednimi aminami; dać pochodne karboksymetylu lub karboksyamidometylu. Mimetyki reszt cysteiny mogą być wytwarzane przez reakcję reszt cysteinowych z, np. bromotrifluoroacetonem, kwasem alfa-bromo-beta-(5imidozoilo) propionowym; fosforanem chloroacetylu, N-alkilomaleimidami, disarczkem 3nitro-2-pirydylu; disarczkem metylowo-2-pirydylowym; p-chlorortęciobenzoesanem; 2chlorortęcio-4 nitrofenolem; lub, chloro-7-nitrobenzo-oksa-1,3-diazolem. Mimetyki lizyny można wytworzyć (i reszty aminowe mogą być zmienione) przez reakcję lizynylowych z, np. bezwodnikiem bursztynowym lub innymi kwasami karboksylowymi. Lizyna i inne zawierające reszty alfa-amino mimetyki można także wytworzyć na drodze reakcji z imidoestrami, jak pikolinoimidan metylu, fosforanem pirydoksalu, pirydoksalem, chloroborowodorkiem, kwasem trinitrobenzenosulfonowym, O-metyloizomocznikiem, 2,4, pentanodionem i reakcjami katalizowanymi transamidazą z glioksylanem. Mimetyki metioniny mogą generowane w reakcji z, np. sulfotlenku metioniny. Mimetyki proliny obejmują, np. kwas pipekolinowy, kwas tiazolidynokarboksylowy, 3- lub 4- hydroksy prolinę, dehydroprolinę, 3- lub 4-metyloprolinę lub 3,3,-dimetyloprolinę. Mimetyki reszty histydyny można wytworzyć przez reakcję histydylu z, np. pirowęglanem dietylu lub bromkiem parabromofenacylu. Inne mimetyki obejmują, np. te generowane przez hydroksylowanie proliny i lizyny; fosforylowanie grup hydroksylowych reszt seryny lub treoniny; metylowanie grup -105- alfa-aminowych lizyny, argininy i histydyny; acetylowanie N-końcowej aminy; metylowanie głównych reszty łańcuchu amidowego lub podstawienie N-metyloaminokwasami; lub amidowanie C-końcowych grup karboksylowych. [0321] Resztę, np. aminokwasu, polipeptydu według wynalazku można również zastąpić aminokwasem (lub resztą peptydomimetyku) o przeciwnej chiralności. Zatem, dowolny aminokwas naturalnie występujący w L-konfiguracji (która może być również określana jako R lub S, w zależności od struktury chemicznej na jednostkę) może być zastąpiona przez aminokwas tego samego chemicznego typu strukturalnego lub peptydomimetykiem, ale o przeciwnej chiralności, określanym jako D-aminokwas, ale także może być dalej określany jako postać R lub S. [0322] Ujawnienie zapewnia również sposoby do modyfikowania polipeptydów według wynalazku poprzez naturalne procesy takie, jak obróbka potranslacyjna (np. fosforylacja, acylowanie itp.), lub poprzez techniki chemicznej modyfikacji, i powstałe modyfikowane polipeptydy. Modyfikacje mogą pojawić się w dowolnym miejscu polipeptydu, w tym w szkielecie peptydowym, łańcuchach bocznych aminokwasów i końcach aminowym lub karboksylowym. Należy zauważyć, że sam rodzaj modyfikacji może być obecny w tym samym lub różnym stopniu w kilku miejscach w danym polipeptydzie. Ponadto dany polipeptyd może mieć wiele typów modyfikacji. Modyfikacje obejmują acetylowanie, acylowanie, ADP-rybozylowanie, amidowanie, kowalencyjne przyłączanie flawiny, kowalencyjne przyłączanie ugrupowania hemowego, kowalencyjne przyłączanie nukleotydu lub pochodnej nukleotydu, kowalencyjne przyłączenie lipidu lub pochodnej lipidu, kowalencyjne przyłączenie fosfatydyloinozytolu, cyklizację krzyżową, tworzenie wiązań dwusiarczkowych, demetylowanie, tworzenie kowalencyjnych wiązań krzyżowych, tworzenie cysteiny, tworzenie piroglutaminianu, formylowanie, gamma-karboksylowanie, glikozylowanie, tworzenie kotwicy GPI, hydroksylowanie, jodowanie, metylowanie, mirystolilowanie, utlenianie, pegylowanie, obróbkę proteolityczną, fosforylowanie, prenylowanie, racemizację, selenoilowanie, siarczanowanie, i addycji za pośrednictwem transferowego RNA aminokwasów do białek taki, jak arginylowanie. Patrz, np. Creighton, T.E., Proteins - Structure and Molecular Properties 2nd Ed., W.H. Freeman and Company, New York (1993); Posttranslational Covalent Modification of Proteins, B.C. Johnson, Ed., Academic Press, New York, str. 1-12 (1983). [0323] Można również stosować sposoby syntezy chemicznej peptydów na fazie stałej, do syntetyzowania polipeptydów lub fragmentów według ujawnienia. Taki sposób jest znany ze stanu techniki od wczesnych lat 1960-tych (Merrifield, R. B., J. Am. Chem. Soc., 85:21492154, 1963) (Patrz, także Stewart, J. M. i Young, J. D., Solid Phase Peptide Synthesis, 2nd Ed., Pierce Chemical Co., Rockford, Ill., str. 11-12)) i zostały niedawno wykorzystane w dostępnych w handlu zestawach do syntezy i projektowania peptydów w laboratorium (Cambridge Research Biochemicals). Tego typu handlowo dostępne zestawy laboratoryjne generalnie wykorzystują ujawnienie H. M. Geysen i wsp, Proc. Natl. Acad. Sci., USA, 81:3998 (1984) i zapewniają syntezowanie peptydów na końcach z wielu ?prętów? lub ?szpilek?, z których wszystkie są podłączone do jednej płytki. Gdy taki system jest -106- wykorzystywany, płytka z prętami lub szpikami jest odwracana i wstawiana do drugiej płytki odpowiednich dołków lub zbiorników, które zawierają roztwory do mocowania bądź zakotwienia odpowiednich aminokwasów do końcówek szpilek lub prętów. Poprzez powtarzanie tego etapu procesu, tj. odwracana i wstawiana końcówki pręta i szpilki do odpowiednich roztworów, aminokwasy są wbudowane w pożądane peptydy. Ponadto dostępnych jest wiele dostępnych systemów syntezy peptydów FMOC. Na przykład, łączenie polipeptydu lub fragmentu może być przeprowadzone na stałym nośniku z użyciem Applied Biosystems, Inc. Model 431A? zautomatyzowanego syntezatora peptydów. Takie wyposażenie zapewnia łatwy dostęp do peptydów według wynalazku, albo przez bezpośrednią syntezę lub przez syntezę szeregu fragmentów, które mogą być sprzęgane za pomocą innych znanych technik. Enzymy fosfolipazy, [0324] Wynalazek zapewnia nowe fosfolipazy, kodujące je kwasy nukleinowe, wiążące je przeciwciała, peptydy reprezentujące miejsca antygenowe enzymów (epitopy) i miejsca aktywne, domeny regulatorowe i wiążące, i sposoby do ich otrzymywania i stosowania. W jednym aspekcie polipeptydy według wynalazku mają aktywność fosfolipazy, lub dowolną kombinację aktywności fosfolipazy, jak tu opisanych (np. przecinanie glicerolofosforanowego wiązania estrowego, brak aktywności lipazy, itd.). W alternatywnych aspektach, fosfolipazy według wynalazku mają aktywności, które zostały zmodyfikowane względem tych dla przykładowych opisanych tu fosfolipaz. [0325] Wynalazek obejmuje fosfolipazy z oraz bez sekwencji sygnałowych i sekwencje sygnałowe same w sobie. Ujawnienie obejmuje fragmenty lub podsekwencje enzymów według ujawnienia, np. peptydy lub polipeptydy zawierające lub składające się z domen katalitycznych (?miejsca aktywne?), miejsc wiązania, domen regulatorowych, epitopów, sekwencji sygnałowych, domen prepro- i podobnych. Ujawnienie obejmuje również unieruchamiane fosfolipazy, przeciwciała przeciwko fosfolipazie i ich fragmenty. Ujawnienie obejmuje heterokompleksy, np. białka fuzyjne, heterodimery, itd., zawierające fosfolipazy według wynalazku. Określanie peptydów reprezentujących miejsca antygenowe enzymu (epitopy), miejsc aktywnych, miejsc wiązania, sekwencji sygnałowych i podobnych może być prowadzone za pomocą rutynowych protokołów badań przesiewowych. [0326] Te enzymy i sposoby według wynalazku można stosować do osiągnięcia bardziej kompletnego odśluzowywania olejów wysokofosforowych, w szczególności oleju ryżowego, sojowego, z kukurydzy, rzepaku canola i słonecznika. Na przykład, po rozszczepieniu PIPLC, fosfatydyloinozytol jest przekształcany do diacyloglicerolu i fosfoinozytolu. Diacyloglicerol przechodzi do fazy wodnej (ulepszając wydajność oleju), a fosfoinozytol przechodzi do fazy wodnej, skąd jest usuwany jako składnik fazy ciężkiej podczas wirowania. Enzym według ujawnienia, np. PI-PLC według ujawnienia, może być włączony w proces chemicznego lub fizycznego rafinowania oleju. [0327] Enzymy według ujawnienia mają specyficzną dla fosfatydyloinozytolu aktywność fosfolipazy C (PI-PLC), specyficzną dla fosfatydylocholiny aktywność fosfolipazy C, -107- aktywność fosfatazy kwasu fosfatydowego, aktywność fosfolipazy A i/lub aktywność fosfolipazy powiązaną z patatyną. Te enzymy można stosować samodzielnie lub w kombinacji ze sobą lub z innymi enzymami według ujawnienia, lub innymi enzymami. W jednym aspekcie, ujawnienie zapewnia sposoby, w których te enzymy (w tym specyficzna dla fosfatydyloinozytolu fosfolipaza C (PIPLC), specyficzna dla fosfatydylocholiny fosfolipaza C, i/lub fosfolipaza D (w połączeniu z fosfatazą), fosfataza kwasu fosfatydowego, fosfolipaza A, fosfolipazy powiązane z patatyną według ujawnienia) są stosowane samodzielnie lub w kombinacji w odśluzowywaniu olejów, np. olejów roślinnych, np. olejów wysokofosforowych takich, jak oleje sojowy, z kukurydzy, z rzepaku canola, z otrębów ryżowych i słonecznikowy. Te enzymy i sposoby według ujawnienia można stosować do osiągnięcia bardziej kompletnego odśluzowywania olejów wysokofosforowych, w szczególności olejów sojowego, z kukurydzy, z rzepaku canola, z otrębów ryżowych i słonecznikowego. Po przecięciu przez PI-PLC, fosfatydyloinozytol jest przekształcany do diacyloglicerolu i fosfoinozytolu. Diacyloglicerol przechodzi do fazy wodnej (ulepszając wydajność oleju), a fosfoinozytol przechodzi do fazy wodnej, skąd jest usuwany jako składnik fazy ciężkiej podczas wirowania. Enzym według ujawnienia, np. PI-PLC według ujawnienia, może być włączony w proces chemicznego lub fizycznego rafinowania oleju. [0328] W jednym aspekcie, wynalazek zapewnia również kompozycje, np. roztwory, zawierające cytrynian sodu w obojętnym pH do uwadniania postaci nieulegającej uwodnieniu. Na przykład, wynalazek zapewnia roztwory cytrynianu sodu w zakresie pH od około 4 do 9, lub 5 do 8, lub 6 do 7, które można stosować do uwadniania nieulegających uwodnieniu fosfolipidów (w tym enzymy według ujawnienia) w olejach wysokofosforowych. W jednym aspekcie, uwodnienie nieulegających uwodnieniu fosfolipidów zachodzi przez chelatowanie wapnia i magnezu powiązanych z fosfolipidami, tym samym umożliwia się wcześniej nierozpuszczalnym solom fosfolipidu łatwiejsze przechodzenie do fazy wodnej. W jednym aspekcie, po przemieszczeniu się fosfolipidów do powierzchni międzyfazowej woda/olej lub do fazy wodnej, fosfolipaza według wynalazku (np. specyficzna dla fosfolipazy fosfohydrolaza według ujawnienia), lub kolejna fosfolipaza, przekształci fosfolipid do diacyloglicerolu i estru fosforanu. W jednym aspekcie, zawartość metali wapnia i magnezu obniża się przez dodawanie kwasu i substancji żrącej (patrz omówienie procesów kaustycznych). [0329] Enzymy według ujawnienia są wysoce selektywnymi katalizatorami. Podobnie jak inne enzymy, katalizują one reakcje z doskonałymi selektywnościami stereo-, regio-, i chemo, które nie mają sobie równych w konwencjonalnej chemii syntetycznej. Ponadto, enzymy według ujawnienia są niezwykle wszechstronne. Można je przystosowywać do funkcjonowania w organicznych rozpuszczalnikach, działania w skrajnych pH (na przykład, wysokim pH i niskim pH) skrajnych temperaturach (na przykład, wysokie temperatury i niskie temperatury), przy skrajnych poziomach zasolenia (na przykład, wysokie zasolenie i niskie zasolenie), i katalizowania reakcji ze związkami, które nie są strukturalnie powiązane z ich naturalnymi, fizjologicznymi substratami. Enzymy według ujawnienia można zaprojektować tak, żeby były reaktywne wobec szerokiego zakresu naturalnych i innych od naturalnych substratów, zatem umożliwiając modyfikację wirtualnie dowolnego organicznego -108- związku ołowiu. Enzymy według ujawnienia można również projektować tak, żeby były wysoce enancjo- i regio- selektywne. Wysoki stopień specyficzności dla grup funkcyjnych, wykazywany przez te enzymy umożliwia śledzenie każdej reakcji w sekwencji syntezy, prowadzącej do nowego aktywnego związku. Enzymy według ujawnienia można również projektować tak, żeby katalizowały wiele różnych reakcji, niezwiązanych z ich naturalną fizjologiczną funkcją w naturze. [0330] Niniejsze ujawnienie wykorzystuje unikalne właściwości katalityczne enzymów. Podczas gdy zastosowanie biokatalizatorów (tj. oczyszczonych lub surowych enzymów nieżywych lub żywych komórek) w przemianach chemicznych, zazwyczaj wymaga identyfikacji określonego biokatalizatora, który reaguje z konkretnym związkiem wyjściowym. Niniejsze ujawnienie wykorzystuje wybrane biokatalizatory, tj. enzymy według ujawnienia, i warunki reakcji, które są specyficzne dla grup funkcyjnych, które są obecne w wielu związkach wyjściowych. Każdy biokatalizator jest specyficzny dla jednej grupy funkcyjnej, lub kilku powiązanych grup funkcyjnych, i może reagować z wieloma związkami wyjściowymi zawierającymi tę grupę funkcyjną. Te reakcje biokatalityczne tworzą populację pochodnych z jednego związku wyjściowego. Te pochodne można poddać kolejnej rundzie reakcji biokatalitycznych celu wytworzenia drugiej populacji związków pochodnych. Tysiące wariacji związku wyjściowego można wytworzyć z każdej iteracji biokatalitycznych pochodnych. [0331] Enzymy reagują w specyficznych miejscach związku wyjściowego, bez wpływu na resztę cząsteczki, w sposób, który jest bardzo trudny do osiągnięcia za pomocą tradycyjnych metod chemicznych. Ten wysoki stopień specyficzności biokatalitycznych zapewnia środki do zidentyfikowania jednego aktywnego enzymu w bibliotece. Biblioteka charakteryzuje serią biokatalitycznych reakcji stosowanych do jej produkcji, tak zwaną ?historią biosyntetyczną?. Badanie przesiewowe biblioteki dla działań biologicznych i śledzenia historii biosyntezy identyfikuje konkretną sekwencję reakcji wytwarzając związek czynny. Sekwencję reakcji powtórzono i struktury zsyntetyzowanego związku określono. Ten sposób identyfikacji, w przeciwieństwie do innych podejść syntezy i przesiewania, nie wymaga technologii unieruchamiających, a związki mogą być zsyntetyzowane i sprawdzone jako wolne w roztworze stosując dowolny typ testu przesiewowego. Ważne jest, aby zauważyć, że wysoki stopień specyficzności reakcji enzymatycznych na grupach funkcyjnych umożliwia ?śledzenie? specyficznych reakcji enzymatycznych, które tworzą biokatalitycznie wytwarzaną bibliotekę. [0332] Ujawnienie zapewnia także sposoby odkrywania nowych fosfolipaz stosując kwasy nukleinowe, polipeptydy i przeciwciała według ujawnienia. W jednym aspekcie, biblioteki fagów lambda przesiewa się pod kątem wykrywania fosfolipaz opartych na ekspresji. Korzystanie z bibliotek faga lambda w badaniach przesiewowych pozwala na wykrycie toksycznych klonów; lepszy dostęp do substratu; zmniejszone zapotrzebowanie na inżynierię gospodarza, z pominięciem jakiejkolwiek możliwości odchylenia wynikającego z odcięcie masy biblioteki; i szybszy wzrost przy niskich gęstościach klonów. Badania przesiewowe bibliotek fagów lambda może być w fazie ciekłej lub w fazie stałej. Badania przesiewowe w -109- fazie ciekłej dają większą elastyczność w warunkach testowych; dodatkową elastyczność substratów; wyższą czułość słabych klonów; i łatwość automatyzacji nad badaniami przesiewowymi w fazie stałej. [0333] Wiele z tych etapów procedury wykonuje się przy użyciu zrobotyzowanych automatycznych urządzeń umożliwiając wykonanie wielu tysięcy reakcji biokatalitycznych i testów przesiewowych dziennie, jak również zapewnienie wysokiego poziomu dokładności i powtarzalności (patrz omówienie tablic, poniżej). W rezultacie można wytwarzać bibliotekę związków pochodnych w ciągu kilku tygodni. W celu uzyskania dalszych informacji o modyfikacji cząsteczek, w tym małych cząsteczek, patrz PCT/US94/09174. Sekwencje sygnałowe fosfolipazy [0334] Ujawnienie zapewnia sekwencje sygnałowe fosfolipazy (np. peptydy sygnałowe (SP)), np. peptydy zawierające sekwencje sygnałowe i/lub polipeptydy chimeryczne, przy czym peptydy lub peptydy chimeryczne mają sekwencję sygnałową jak podano w Tabeli 1, lub jak podano poniżej. Ujawnienie zapewnia kwasy nukleinowe kodujące te sekwencje sygnałowe (SP, np. peptyd mający sekwencję zawierającą/składającą się z reszt na końcu aminowym polipeptydu według ujawnienia). W jednym aspekcie, ujawnienie zapewnia sekwencję sygnałową zawierającą peptyd zawierający/ składający się z sekwencji jak podano, z reszt 1 do 20, 1 do 21, 1 do 22, 1 do 23, 1 do 24, 1 do 25, 1 do 26, 1 do 27, 1 do 28, 1 do 28, 1 do 30, 1 do 31, 1 do 32 lub 1 do 33 polipeptydu według ujawnienia, np. SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:74, SEQ ID NO:76, SEQ ID NO:78, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, SEQ ID NO:92, SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:102, SEQ ID NO:104, SEQ ID NO:106, SEQ ID NO:108 SEQ ID NO:110, SEQ ID NO:112, SEQ ID NO:114, SEQ ID NO:116, SEQ ID NO:118, SEQ ID NO:120, SEQ ID NO:122, SEQ ID NO:124, SEQ ID NO:126, SEQ ID NO:128, SEQ ID NO:130, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:136, SEQ ID NO:138; SEQ ID NO:140 SEQ ID NO:142; SEQ ID NO:144; NO:146, SEQ ID NO:148, SEQ ID NO:150, SEQ ID NO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ ID NO:168, SEQ ID NO:170, SEQ ID NO:172, lub SEQ ID NO:174. Dowolne z tych peptydów mogą stanowić część białka chimerycznego, np. rekombinowane białko. Peptyd sekwencji sygnałowej można dopasować do kolejnego enzymu według ujawnienia (np. fosfolipazy według wynalazku, z której nie pochodzi), lub kolejnej fosfolipazy, lub dowolnego polipeptydu, jak omówiono dokładniej poniżej. [0335] Przykładowe sekwencje sygnałowe są podane w Tabeli 1 i liście SEQ ID, np. reszty 1 do 24 SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6; reszty 1 do 29 SEQ ID NO:8; reszty 1 do -110- 20 SEQ ID NO:10; reszty 1 do 19 SEQ ID NO:20; reszty 1 do 28 SEQ ID NO:22; reszty 1 do 20 SEQ ID NO:32; reszty 1 do 23 SEQ ID NO:38; patrz Tabela 1 i lista SEQ ID aby zapoznać się z innymi przykładowymi sekwencjami sygnałowymi według ujawnienia. [0336] W niektórych aspektach fosfolipazy według wynalazku nie mają sekwencji sygnałowych. W jednym aspekcie wynalazek zapewnia fosfolipazy według wynalazku pozbawione całości lub części sekwencji sygnałowej. W jednym aspekcie wynalazek zapewnia sekwencję kwasu nukleinowego kodującą sekwencję sygnałową z jednej fosfolipazy funkcjonalnie połączonej z sekwencją kwasu nukleinowego innej fosfolipazy lub, opcjonalnie, pożądane mogą być sekwencje sygnałowe z białka innego niż fosfolipaza. Domeny prepro fosfolipazy, domeny wiążące i domeny katalityczne [0337] Oprócz sekwencji sygnałowych (np. peptydów sygnałowych (SP)), jak omówiono powyżej, ujawnienie zapewnia domeny prepro, domeny wiążące (np. domena wiążąca substrat) i domeny katalityczne (CD). Domeny SP, domeny wiążące, domeny prepro i/lub CD według ujawnienia mogą być wyizolowanymi lub rekombinowanymi peptydami lub mogą stanowić część białka fuzyjnego, np. jako heterologiczna domena w białku chimerycznym. Ujawnienie zapewnia kwasy nukleinowe kodujące te domeny katalityczne (CD) (np. ?miejsca aktywne?), domeny prepro, domeny wiążące i te sekwencje sygnałowe (SP, np. peptyd mający sekwencję zawierającą/składającą się z reszt na końcu aminowym polipeptydu według wynalazku). [0338] Sekwencje sygnałowe fosfolipazy (SP), domeny wiążące, domeny katalityczne (CD) i/lub sekwencje prepro według ujawnienia mogą oznaczać izolowane peptydy, lub sekwencje połączone z kolejną fosfolipazą lub polipeptydem innym niż fosfolipaza, np. jako (chimeryczne) białko fuzyjne. W jednym aspekcie, polipeptydy zawierające sekwencje sygnałowe fosfolipazy SP i/lub prepro według ujawnienia obejmują sekwencje heterologiczne do fosfolipaz według wynalazku (np. białko fuzyjne zawierające SP i/lub prepro według ujawnienia i sekwencje z kolejnej fosfolipazy lub białka innego niż fosfolipaza). W jednym aspekcie, wynalazek zapewnia również fosfolipazy według wynalazku z heterologicznymi sekwencjami CD, SP i/lub prepro, np. sekwencje z drożdżową sekwencją sygnałową. Fosfolipaza według wynalazku może zawierać heterologiczne CD, SP i/lub prepro w wektorze, np. wektorze serii pPIC (Invitrogen, Carlsbad, CA). [0339] W jednym aspekcie, SP, CD, i/lub sekwencje prepro według ujawnienia są identyfikowane po identyfikacji nowych polipeptydów fosfolipazy. Szlaki, przez które białka są sortowane i transportowane do ich właściwego położenia komórkowej są często określane jako szlaki kierowania białka. Jednym z najważniejszych elementów we wszystkich tych układach kierowania jest krótkoaminokwasowa sekwencja na końcu aminowym nowo syntetyzowanego polipeptydu zwana sekwencją sygnałową. Ta sekwencja sygnałowa kieruje białko do jej właściwego położenia w komórce i jest usuwana podczas transportu i gdy białko osiąga ostateczne miejsca przeznaczenia. Większość lizosomalnych, błonowych lub wydzielanych białek ma sekwencję amino-końcową sekwencję sygnałową, która oznacza ich translokację do światła retikulum endoplazmatycznego. Sekwencje sygnałowe mogą różnić -111- się długością od 13 do 45 lub więcej reszt aminokwasowych. Różne metody rozpoznawania sekwencji sygnałowych są znane znawcom w tej dziedzinie techniki. Na przykład, w jednym aspekcie, nowe peptydy sygnałowe hydrolazy są zidentyfikowane metodą dalej zwaną SignalP. SignalP wykorzystuje połączoną sieć neuronową, która rozpoznaje zarówno peptydy sygnałowe i ich miejsca cięcia. (Nielsen, i wsp., ?Identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites.? Protein Engineering, vol. 10, no. 1, str. 1-6 (1997). [0340] W pewnych aspektach, fosfolipaza według wynalazku może nie mieć SP i/lub sekwencji prepro, i/lub domen katalitycznych (CD). W jednym aspekcie, ujawnienie zapewnia fosfolipazy pozbawione całości lub część SP, CD i/lub domeny prepro. W jednym aspekcie, wynalazek zapewnia sekwencję kwasu nukleinowego kodującą sekwencję sygnałową (SP), CD i/lub prepro z jednej fosfolipazy połączonej funkcjonalnie do sekwencji kwasu nukleinowego innej fosfolipazy lub, ewentualnie, może być pożądana sekwencja sygnałowa (SP), CD i/lub domeny prepro z białka innego niż fosfolipaza. [0341] Wynalazek zapewnia także wyizolowane lub rekombinowane polipeptydy zawierające sekwencje sygnałowe (SP), domeny prepro i/lub domeny katalityczne (CD) według wynalazku i sekwencje heterologiczne. Heterologiczne sekwencje są sekwencjami niezwiązanymi naturalnie (np. z fosfolipazą) z SP, domeną prepro i/lub CD. Sekwencja, z którą SP, domena prepro i/lub CD nie są naturalnie związane, mogą być na końcu aminokońcowym SP, domeny prepro i/lub CD, końcu karboksykońcowym, i/lub na obu końcach SP i/lub CD. W jednym aspekcie, wynalazek zapewnia wyizolowany lub rekombinowany polipeptyd zawierający (lub składający się z) polipeptyd zawierający sekwencję sygnałową (SP), domenę prepro i/lub domenę katalityczną (CD) według wynalazku z zastrzeżeniem, że nie są związane z żadną sekwencją, do której jest naturalnie związana (np. sekwencją fosfolipazy). Podobnie, w jednym aspekcie, wynalazek zapewnia wyizolowane lub rekombinowane kwasy nukleinowe kodujące te polipeptydy. Zatem, w jednym aspekcie, wyizolowany lub rekombinowany kwas nukleinowy według wynalazku zawiera sekwencję kodującą sekwencję sygnałową (SP), domenę prepro i/lub domenę katalityczną (CD) według wynalazku oraz sekwencję heterologiczną (tj. sekwencję niezwiązaną naturalnie z sekwencją sygnałową (SP), domeną prepro i/lub domeną katalityczną (CD) według wynalazku). Heterologiczna sekwencja może być na końcu 3' końcowym, końcu 5' końcowym, i/lub na obu końcach sekwencji kodującej SP, domenę prepro i/lub CD. [0342] Polipeptydy według wynalazku obejmują fosfolipazy w postaci aktywnej lub nieaktywnej. Na przykład, polipeptydy według wynalazku obejmują probiałka przed ?dojrzewaniem? lub przetwarzaniem sekwencji prepro, np. przez enzym do przetwarzania probiałka taki, jak konwertaza probiałka generująca ?aktywne? dojrzałe białko. Polipeptydy według wynalazku obejmują fosfolipazy nieaktywne z różnych powodów, np. przed ?aktywacją? przez zdarzenie obróbki potranslacyjnej, np. za pomocą działania endo- lub egzo-peptydazy lub proteinazy, zdarzenie fosforylacyjne, amidowanie, glikozylację, deglikozylację, nasiarczanie, zdarzenie dimeryzacyjne i/lub podobne. Sposoby do -112- identyfikowania sekwencji domen ?prepro?, CD, domen wiążących i sekwencji sygnałowych są rutynowe i dobrze znane ze stanu techniki, patrz np. Van de Ven (1993) Crit. Rev. Oncog. 4(2):115-136; dwuhybrydowe badania przesiewowe na drożdżach dla identyfikowania oddziaływań białko-białko, opisane np. przez Miller (2004) Methods Mol. Biol. 261:247-62; Heyninck (2004) Methods Mol. Biol. 282:223-41, USPN 6,617,122; 6,190,874. Na przykład, aby zidentyfikować sekwencję prepro, białko jest oczyszczane z przestrzeni pozakomórkowej, określa się N-końcową sekwencję białkową i porównuje do postaci niepoddawanej obróbce. [0343] Polipeptydy według ujawnienia można poddawać formulacji do postaci preparatu białkowego, w dowolnej postaci ciekłej, stałej, półstałej lub żelu. Na przykład, preparat białkowy według ujawnienia może zawierać formulację zawierającą niewodną kompozycję ciekłą, odlewane ciało stałe, proszek, liofilizowany proszek, postać granulowaną, postać rozdrobnionych cząstek, prasowaną tabletkę, peletkę, pigułkę, postać żelu, hydrożel, pastę, aerozol, rozpylacz, płyn do przemywania lub formulację gęstej zawiesiny. [0344] Polipeptydy według wynalazku obejmują wszystkie aktywne postaci, w tym aktywne podsekwencje, np. domeny katalityczne (CD) lub miejsca aktywne enzymu według wynalazku. W jednym aspekcie, ujawnienie zapewnia domeny katalityczne lub miejsca aktywne jak podano poniżej. W jednym aspekcie, ujawnienie zapewnia peptyd lub polipeptyd zawierający lub składający się z domeny miejsca aktywnego, jak przewidziano dzięki zastosowaniu bazy danych takiej, jak Pfam (która stanowi duży zbiór wielu dopasowani sekwencji i ukrytych modeli Markova obejmujących wiele popularnych rodzin białek, The Pfam protein families database, A. Bateman, E. Birney, L. Cerruti, R. Durbin, L. Etwiller, S.R. Eddy, S. Griffiths-Jones, K.L. Howe, M. Marshall, i E.L.L. Sonnhammer, Nucleic Acids Research, 30(1):276-280, 2002) lub odpowiednik. [0345] Ujawnienie zapewnia fuzję N-końcowych lub C-końcowych podsekwencji enzymów według ujawnienia (np. sekwencje sygnałowe, sekwencje prepro) z innymi polipeptydami, aktywnymi białkami lub fragmentami białek. Produkcję enzymu według ujawnienia (np. enzymu fosfolipaza C) można również realizować przez ekspresję enzymu jako nieaktywne białko fuzyjne, które jest następnie aktywowane przez zdarzenie rozszczepienia proteolitycznego (przy użyciu endogennej lub egzogennej aktywności proteazy, np. trypsyny), które powoduje rozdzielenie partnera białka fuzyjnego i dojrzałego enzymu, np. enzymu fosfolipazy C. W jednym aspekcie, białko fuzyjne według ujawnienia ulega ekspresji z hybrydowego konstruktu nukleotydowego, który koduje pojedynczą otwartą ramkę odczytu zawierającą następujące elementy: sekwencję nukleotydową dla białka fuzyjnego, sekwencję łącznikową (zdefiniowaną jako sekwencja nukleotydowa, która koduje elastyczną sekwencję aminokwasową, która łączy dwie mniej elastyczne domeny białkowe), miejsce rozszczepienia rozpoznawane przez proteazę i sekwencję dojrzałego enzymu (np. dowolny enzym według wynalazku, np. fosfolipaza). W alternatywnych aspektach, białko fuzyjne może zawierać sekwencję liazy pektynianowej, sekwencję ksylanazy, sekwencję fosfatazy kwasu fosfatydowego, lub inną sekwencję, np. sekwencję, która okazała się poprzednio, że ulega nadmiernej ekspresji w układzie gospodarza będącego przedmiotem zainteresowania. -113- [0346] Można stosować dowolny układ gospodarzy (patrz omówienie powyżej), na przykład, dowolne bakterie, np. bakterie Gram-dodatnie takie, jak Bacillus, lub bakterie Gram-ujemne takie, jak E. coli, lub dowolne drożdże, np. Pichia pastoris. Ułożenie sekwencji nukleotydowych w konstrukcie chimerycznych nukleotydów można wyznaczyć w oparciu o poziomy ekspresji białka osiągane dla każdego konstruktu fuzyjnego. Począwszy od końca 5' nukleotydowego konstruktu, do końca 3' prim konstruktu, w jednym aspekcie, sekwencje nukleotydowe składa się jak następuje: Sekwencja sygnałowa/białko fuzyjne/sekwencja łącznika/miejsce cięcia rozpoznawane przez proteazę/dojrzały enzym (np. dowolny enzym według wynalazku, np. fosfolipaza) lub sekwencja sygnałowa/ pro sekwencja/dojrzały enzym/sekwencja łącznika/białko fuzyjne. Ekspresja enzymu (np. dowolnego enzymu według wynalazku, np. fosfolipazy) jako nieaktywnego białka fuzyjnego może polepszyć ogólną ekspresję sekwencji enzymu, może obniżyć jakąkolwiek potencjalną toksyczność powiązaną z nadprodukcją aktywnego enzymu i/lub może wydłużyć okres trwałości enzymu przed użyciem, ponieważ enzym będzie nieaktywny do momentu oddzielenia białka fuzyjnego np. za pomocą liazy pektynowej od enzymu, np. fosfolipazy białkowej. [0347] W różnych aspektach, ujawnienie zapewnia konkretne formulacje dla aktywacji fosfolipazy według ujawnienia eksprymowanej jako białko fuzyjne. W jednym aspekcie, aktywacja aktywności fosfolipazy wstępnie eksprymowanej jako nieaktywne białko fuzyjne realizuje się stosując aktywność proteolityczną lub potencjalną aktywność proteolityczną w połączeniu z peptydazą aminokońcową lub karboksylokońcową. To zdarzenie aktywacji można przeprowadzić na różne sposoby i w różnych punktach procesu produkcyjnego/przechowywania przed zastosowaniem w odśluzowywaniu oleju. Przykładowe sposoby według ujawnienia obejmują: Rozszczepienie przez endogenną aktywność wyeksprymowanej przez wytwarzającego gospodarza po wydzieleniu konstruktu fuzyjnego w pożywce fermentacyjnej; Rozszczepienie przez endogenną aktywność proteazy, która jest aktywowana lub styka się z wewnątrzkomórkowo wyeksprymowanym konstruktem fuzyjnym po rozerwaniu komórek gospodarza; Przejście surowego lub oczyszczonego konstruktu fuzyjnego przez kolumnę z unieruchomioną aktywnością proteazy aby osiągnąć rozszczepienie i aktywację enzymu (np. fosfolipazy według wynalazku,) przed sformułowaniem enzymu; Traktowanie surowego lub oczyszczonego konstruktu fuzyjnego rozpuszczalnym źródłem aktywności proteolitycznej; Aktywacja fosfolipazy (np. fosfolipazy według wynalazku) w rafinerii oleju, używając albo rozpuszczalne lub nierozpuszczalne źródło aktywności proteolitycznej bezpośrednio przed użyciem w procesie; i/lub, Aktywacja aktywności fosfolipazy (np. fosfolipazy według wynalazku,) przez ciągłą cyrkulację formulacji konstruktu fuzyjnego przez kolumnę z unieruchomioną aktywnością proteazy w obniżonej temperaturze (na przykład, dowolnej pomiędzy około 4°C i 20°C). To zdarzenie aktywacji można przeprowadzić przed dostawą do miejsca użytkowania lub może wystąpić w miejscu, w zakładzie rafinacji oleju. Glikozylacja [0348] Peptydy i polipeptydy według wynalazku (np. hydrolazy, przeciwciała) mogą być również glikozylowane, na przykład, w jednym aspekcie, zawierają co najmniej jedno miejsce -114- glikozylacji, np. N-glikozylacji lub O-glikozylacji. W jednym aspekcie, polipeptyd może być glikozylowany po eksprymowaniu w P. pastoris lub S. pombe. Glikozylację można dodawać potranslacyjnie, chemicznie lub za pomocą komórkowych mechanizmów biosyntezy, przy czym to ostatnie wiąże się ze stosowaniem znanych motywów glikozylacji, które mogą być natywne dla sekwencji, lub można ją dodawać jako peptyd lub dodawać do sekwencji kodującej kwasu nukleinowego. [0349] W jednym aspekcie, ujawnienie zapewnia polipeptyd N-glikozylowany SEQ ID NO: 2, jak opisano, np. w poniższej tabeli: Numer miejsca Miejsce glikozylacji Długość 1 Dopasowanie: NNS Długość: 3 Start: 27 Stop: 29 2 Dopasowanie: NTT Długość: 3 Start: 65 Stop: 67 3 Dopasowanie: NET Długość: 3 Start: 72 Stop: 74 4 Dopasowanie: NST Długość: 3 Start: 100 Stop: 102 5 Dopasowanie: NFT Długość: 3 Start: 168 Stop: 170 6 Dopasowanie: NLS Długość: 3 Start: 171 Stop: 173 7 Dopasowanie: NDT Długość: 3 Start: 229 Stop: 231 Pozycja aminokwasowa miejsca glikozylacji [0350] Otwarta ramka odczytu pełnej długości SEQ ID NO:2 (która w jednym przykładzie jest kodowana przez SEQ ID NO:1) koduje siedem (7) potencjalnych, połączonych asparaginą (N-glikozylowanych) miejsc glikozylacji. Ekspresja otwartej ramki odczytu SEQ ID NO:2 typu dzikiego w glikozylującym gospodarzu (np. Pichia pastoris, Saccharomyces cerevisiae, Schizosaccharomyces pombe, lub komórka ssacza) powoduje produkcję glikozylowanego enzymu fosfolipazy SEQ ID NO:2, który jest zasadniczo nieaktywny ze względu na obecność N-glikozylacji. Enzymatyczna deglikozylacja glikozylowanej SEQ ID NO:2 typu dzikiego, za pomocą PNGazy F lub endoglikozydazy H powoduje aktywację aktywności SEQ ID NO:2. Dodatkowo, modyfikacja jednego lub więcej z miejsc Nglikozylacji poprzez mutagenezę (tak, że miejsce nie jest dłużej rozpoznawane jako miejsce N-glikozylacji, i nie dochodzi już do glikozylacji w tym miejscu) powoduje produkcję SEQ ID NO:2 o zróżnicowanym stopniu podwyższonej aktywności. [0351] Mutageneza nukleotydowego kodonu kodującego asparaginę w miejscu glikozylacji SEQ ID NO:2 4, 5 i/lub 6 (np. przekształcanie asparaginy do kwasu asparaginowego) -115- powoduje produkcję enzymu o podwyższonej aktywności PLC w porównaniu do otwartej ramki odczytu typu dzikiego, eksprymowanej u tego samego gospodarza (potrójny mutant eksprymowany w Pichia pastoris posiada aktywność specyficzną i funkcjonalną aktywność, która jest zasadniczo identyczna z tą dla sekwencji typu dzikiego eksprymowanej w nieglikozylującym gospodarzu jak E. coli. Jest również możliwe, aby zlikwidować miejsce Nglikozylacji przez mutagenezę reszty seryny lub treoniny w sekwencji konsensusowej Nglikozylacji (NXS/T), na przykład przez przekształcanie tych nukleotydowych kodonów tak, żeby produkowały walinę lub izoleucynę w tych pozycjach zamiast seryny lub treoniny. Stosowanie tej strategii do usunięcia miejsca N-glikozylacji powoduje również produkcję aktywnej fosfolipazy SEQ ID NO:2 w układach ekspresyjnych z glikozylującym gospodarzem. Oznaczenia aktywności fosfolipazy [0352] Wynalazek zapewnia izolowane, syntetyczne lub rekombinowane polipeptydy (np. enzymy, przeciwciała) mające aktywność fosfolipazy, lub dowolną kombinację aktywności fosfolipazy, i kodujące je kwasy nukleinowe. Można stosować dowolne z wielu oznaczeń aktywności fosfolipazy, znanych ze stanu techniki, aby określić czy polipeptyd ma aktywność fosfolipazy i pozostaje w obrębie zakresu wynalazku. Rutynowe protokoły do określania aktywności fosfolipazy A, B, D i C, patatyny i hydrolazy acylolipidów lub aktywności lipazy są dobrze znane ze stanu techniki. [0353] Przykładowe oznaczenia aktywności obejmują oznaczenia mętności, oznaczenia metyloumbeliferylofosfocholiny (fluorescencyjne), oznaczenia Amplex red (fluorescencyjne) fosfolipazy, oznaczenia chromatografii cienkowarstwowej (TLC), oznaczenia cytolityczne i oznaczenia p-nitro-fenylofosforylocholiny. Przy użyciu tych oznaczeń można szybko analizować polipeptydy, peptydy lub przeciwciała, badane przesiewowo pod kątem aktywności fosfolipazy. [0354] Aktywność fosfolipazy może obejmować aktywność hydrolazy acylolipidowej (LAH). Patrz np. Jimenez (2001) Lipids 36:1169-1174, opisujący oznaczenie mieszane micelarne, oparte na eterze monododecylowym glikolu oktaetylenowego, do określania aktywności hydrolazy acylolipidów patatyny. Pinsirodom (2000) J. Agric. Food Chem. 48:155-160, opisuje przykładową aktywność hydrolazy acylolipidów (LAH) patatyny. [0355] Oznaczenia mętności, do określenia aktywności fosfolipazy opisano, np. w Kauffmann (2001) ?Conversion of Bacillus thermocatenulatus lipase into an efficient phospholipase with increased activity towards long-chain fatty acyl substrates by directed evolution and rational design? Protein Engineering 14:919-928; Ibrahim (1995) ?Evidence implicating phospholipase as a virulence factor of Candida albicans? Infect. Immun. 63:1993-1998. [0356] Oznaczenia (fluorescencyjne) metyloumbeliferylofosfocholiny, do określenia aktywności fosfolipazy opisano, np. w Goode (1997) ?Evidence for cell surface and internal phospholipase activity in ascidian eggs? Develop. Growth Differ. 39:655-660; Diaz (1999) ?Direct fluorescence-based lipase activity assay? BioTechniques 27:696-700. -116- [0357] Oznaczenia (fluorescencyjne) Fosfolipazy Amplex Red, do określenia aktywności fosfolipazy są dostępne jako zestawy, np. wykrywanie fosfolipazy specyficznej dla fosfatydylocholiny przy użyciu zestawu Amplex Red do oznaczania fosfolipazy specyficznej dla fosfatydylocholiny, z Molecular Probes Inc. (Eugene, OR), zgodnie z instrukcjami producenta. Fluorescencję mierzy się za pomocą czytnika do fluorescencji, do mikropłytek, przy użyciu wzbudzenia przy długości fali 560 ? 10 nm i wykrywania fluorescencji przy długości fali 590 ? 10 nm. Oznaczenie jest czułe na bardzo niskie stężenia enzymu. [0358] Oznaczenia chromatografii cienkowarstwowej (TLC), do określenia aktywności fosfolipazy opisano, np. w Reynolds (1991) Methods in Enzymol. 197:3-13; Taguchi (1975) ?Phospholipase from Clostridium novyi type A.I? Biochim. Biophys. Acta 409:75-85. Chromatografia cienkowarstwowa (TLC) jest powszechnie stosowaną techniką do wykrywania aktywności fosfolipazy. Stosowano różne modyfikacje tego sposobu, do ekstrahowania fosfolipidów z wodnych mieszanin do oznaczania. W niektórych oznaczeniach PLC hydrolizę zatrzymuje się przez dodawanie chloroformu/metanolu (2:1) do mieszaniny reakcyjnej. Nieprzereagowany materiał wyjściowy i diacyloglicerol są ekstrahowane do fazy organicznej i mogą być frakcjonowane za pomocą TLC, podczas gdy czołowy produkt główny pozostaje w fazie wodnej. Dla dokładniejszego pomiaru trawienia fosfolipidów można stosować substraty znakowane promieniotwórczo (patrz np. Reynolds (1991) Methods in Enzymol. 197:3-13). Można wykorzystywać proporcje produktów i reagentów do wyliczenia faktycznej liczby moli substratu hydrolizowanego na jednostkę czasu. Jeśli wszystkie składniki są ekstrahowane w równym stopniu, jakiekolwiek straty w ekstrakcji będą równo oddziaływać na wszystkie składniki. Rozdział trawionych produktów fosfolipidów można osiągnąć dzięki żelowi krzemionkowemu TLC z chloroformem /metanolem/wodą (65:25:4) stosowanymi jako system rozpuszczalników (patrz np. Taguchi (1975) Biochim. Biophys. Acta 409:75-85). [0359] Oznaczenia p-nitrofenylofosforylocholiny do określenia aktywności fosfolipazy opisano np. w Korbsrisate (1999) J. Clin. Microbiol. 37:3742-3745; Berka (1981) Infect. Immun. 34:1071-1074. To oznaczenie bazuje na enzymatycznej hydrolizie analogu substratu p-nitrofenylofosforylocholiny, do uwolnienia żółtego chromogennego związku p-nitro-fenolu, wykrywalnego przy długości fali 405 nm. Ten substrat jest dogodny do wysokowydajnych badań przesiewowych. [0360] Oznaczenie cytolityczne może wykrywać fosfolipazy o aktywności cytolitycznej, w oparciu o lizę erytrocytów. Toksyczne fosfolipazy mogą oddziaływać z błonami komórek eukariotycznych i hydrolizować fosfatydylocholinę i sfingomielinę, prowadząc do lizy komórki. Patrz np. Titball (1993) Microbiol. Rev. 57:347-366. Hybrydowe (chimeryczne) fosfolipazy i biblioteki peptydów [0361] W jednym aspekcie, ujawnienie zapewnia hybrydowe fosfolipazy i białka fuzyjne, w tym biblioteki peptydów, zawierające sekwencje według wynalazku. Biblioteki peptydowe według ujawnienia mogą być stosowane do izolowania modulatorów peptydów (np. aktywatorów lub inhibitorów) celów takich, jak substraty, receptory, enzymy fosfolipazy. -117- Biblioteki peptydowe według ujawnienia mogą być stosowane do identyfikacji formalnych partnerów wiążących celów takich, jak ligandy, np. cytokiny, hormony i tym podobne. W jednym aspekcie, ujawnienie zapewnia białka chimeryczne zawierające sekwencję sygnałową (SP) i/lub domenę katalityczną (CD) według ujawnienia oraz sekwencję heterologiczną (patrz wyżej). [0362] Ujawnienie zapewnia również sposoby do generowania ?ulepszonych? i hybrydowych fosfolipaz, przy użyciu kwasów nukleinowych i polipeptydów według wynalazku. Na przykład, ujawnienie zapewnia sposoby do generowania enzymów, które mają aktywność, np. aktywność fosfolipazy (taką jak np. aktywność fosfolipazy A, B, C lub D, aktywność esterazy patatyny, przecinanie glicerolofosforanowego wiązania estrowego, przecinanie wiązania estrowego w fosfolipidzie w oleju roślinnym) w skrajnie zasadowym pH i/lub kwasowym pH, wysokich i niskich temperaturach, warunkach osmotycznych i podobnych. Ujawnienie zapewnia sposoby do generowania hybrydowych enzymów (np. hybrydowych fosfolipaz). [0363] W jednym aspekcie, sposoby według ujawnienia tworzą nowe polipeptydy hybrydowe z wykorzystaniem procesów komórkowych, które integrują się z pierwszą sekwencją polinukleotydu tak, że uzyskane hybrydowe polinukleotydy kodują polipeptydy wykazujące aktywności pochodzące z pierwszych biologicznie aktywnych polipeptydów. Na przykład, pierwsze polinukleotydy mogą być przykładową sekwencją kwasu nukleinowego (np. SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, itd.) kodującą przykładową fosfolipazę według ujawnienia (np. SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, itd.). Pierwszy kwas nukleinowy może kodować enzym z jednego organizmu, który skutecznie działa w ramach konkretnych warunków środowiskowych, np. wysokie zasolenie. Może być ?zintegrowany? z enzymem kodowanym przez drugi polinukleotyd z innego organizmu, który działa skutecznie w ramach innych warunków środowiskowych takich, jak skrajnie wysokie temperatury. Na przykład, gdy dwa kwasy nukleinowe mogą wytwarzać hybrydowe cząsteczki przez np. rekombinację i/lub redukcyjną reasortację. Hybrydowy polinukleotyd zawierający sekwencje z pierwszych i drugich pierwotnych polinukleotydów może kodować enzym, który wykazuje cechy obu enzymów kodowanych przez oryginalne polinukleotydy. Tak więc, enzym kodowany przez hybrydowy polinukleotyd może skutecznie działać w warunkach środowiskowych współdzielonych przez każdy z enzymów kodowanych przez polinukleotydy pierwszy i drugi, na przykład, wysokie zasolenie i skrajne temperatury. [0364] Alternatywnie, hybrydowy polipeptyd wynikający z tego sposobu według ujawnienia może wykazywać wyspecjalizowaną aktywność enzymu nieprezentowaną w oryginalnych enzymach. Na przykład, po rekombinacji i/lub redukcyjnej reasortacji polinukleotydów kodujących aktywności fosfolipazy, otrzymany polipeptyd hybrydowy kodowany przez hybrydowy polinukleotyd można przeszukiwać pod kątem wyspecjalizowanych aktywności otrzymanych z każdego z pierwotnych enzymów, tj. typu wiązania, na które fosfolipaza działa i temperatury, w której fosfolipaza funkcjonuje. Tak więc, na przykład, fosfolipazę można przeszukiwać w celu ustalenia tych funkcji chemicznych, które odróżniają hybrydową fosfolipazę od pierwotnych fosfolipaz takich, jak: (a) amid (wiązania peptydowe), tj. -118- fosfolipazy; (b) wiązania estrowe, tj. fosfolipazy i lipazy; (c) acetale, tj. glikozydazy i, na przykład, temperatura, pH lub stężenie soli, w których funkcjonuje hybrydowy polipeptyd. [0365] Źródła polinukleotydów do ?zintegrowania? z kwasami nukleinowymi według ujawnienia mogą być izolowane z poszczególnych organizmów (?izolaty?), zbiorów organizmów, które zostały wyhodowane w określonych pożywkach (?hodowle wzbogaceniowe?), lub, niehodowanym organizmów (?próbki środowiskowe?). Zastosowanie podejścia niezależnego od hodowli w celu uzyskania polinukleotydów kodujących nowe aktywności biologiczne z próbek środowiskowych jest najbardziej korzystne, ponieważ pozwala na dostęp do niewykorzystanych zasobów różnorodności biologicznej. ?Biblioteki środowiskowe? generuje się w próbkach środowiskowych i reprezentują one zbiorowe genomy naturalnie występujących organizmów zarchiwizowanych w wektorach do klonowania, które mogą być rozmnażane w odpowiednich gospodarzach prokariotycznych. Ponieważ początkowo klonowany DNA ekstrahuje się bezpośrednio z próbek środowiskowych, biblioteki nie ograniczają się do niewielkiej części prokariontów, które mogą być uprawiane w czystej hodowli. Dodatkowo, normalizacja DNA środowiskowego obecnego w tych próbkach może pozwolić na równą reprezentację DNA ze wszystkich gatunków występujących w oryginalnej próbce. To może znacząco zwiększyć skuteczność znalezienia interesujących genów z pomniejszych składników próbki, które mogą być niedostatecznie reprezentowane o kilka rzędów wielkości w porównaniu z dominującą formą. [0366] Na przykład, biblioteki genowe z jednego lub większej liczby niehodowanych mikroorganizmów przesiewa się pod kątem aktywności będącej przedmiotem zainteresowania. Potencjalne szlaki kodujące bioaktywne cząsteczki będące przedmiotem zainteresowania najpierw wychwytuje się w komórkach prokariotycznych, w postaci bibliotek ekspresji genu. Polinukleotydy kodujące aktywności będące przedmiotem zainteresowania izoluje się z takich bibliotek i wprowadza do komórki gospodarza. Komórkę gospodarza hoduje się w warunkach, które promują rekombinację i/lub redukcyjną reasortację tworząc potencjalnie aktywne biomolekuły z nowymi lub ulepszonymi aktywnościami. [0367] Mikroorganizmy, z których można otrzymać polinukleotydy hybrydowe obejmują komórki prokariotyczne takie, jak mikroorganizmy Eubacteria i Archaebacteria, i niższe mikroorganizmy eukariotyczne takie, jak grzyby, glony i niektóre pierwotniaki. Polinukleotydy mogą być izolowane z próbek środowiskowych. Kwas nukleinowy może być odzyskany bez hodowli organizmu lub odzyskiwane z jednego lub większej liczby organizmów hodowlanych. W jednym aspekcie, mikroorganizmy te mogą być ekstremofilami takimi, jak hipertermofile, kriofile, psychrotrofile, halofile, barofile i acydofile. W jednym aspekcie, polinukleotydy kodujące enzymy fosfolipazy izolowane z mikroorganizmów ekstremofilnych są wykorzystywane do wytwarzania enzymów hybrydowych. Takie enzymy mogą działać w temperaturach powyżej 100°C w, np. naziemnych gorących źródłach i otworach termicznych na otwartym morzu, w temperaturach poniżej 0°C w, np. arktycznych wodach, w środowisku nasyconej soli, np. Morzu Martwym, w wartościach pH około 0 w, np. złożach węgla i źródłach geotermalnych bogatych w siarkę, lub w wartościach pH większych niż 11 w, np. osadach ściekowych. Na przykład, fosfolipazy sklonowane i poddane ekspresji z -119- organizmów ekstremofilnych mogą wykazywać wysoką aktywność w szerokim zakresie temperatur i pH. [0368] Opisane tu polinukleotydy selekcjonowane i izolowane, w tym co najmniej jeden kwas nukleinowy według wynalazku, są wprowadzane do odpowiedniej komórki gospodarza. Odpowiednia komórka gospodarza jest dowolną komórką, która jest zdolna do promowania rekombinacji i/lub redukcyjnej reasortacji. Wybrane polinukleotydy mogą być wektorem, który zawiera odpowiednie sekwencje kontrolne. Komórką gospodarza może być wyższa komórka eukariotyczna taka, jak komórka ssacza, lub niższa komórka eukariotyczna taka, jak komórka drożdżowa, lub, korzystnie, komórką gospodarza może być komórka prokariotyczna taka, jak komórka bakteryjna. Wprowadzenie konstruktu do komórki gospodarza może być dokonane poprzez transfekcję fosforanem wapnia, transfekcję z udziałem DEAE-dekstranu, lub elektroporację (Davis i wsp., 1986). [0369] Przykłady odpowiednich gospodarzy obejmują komórki bakteryjne takie, jak E. coli, Streptomyces, Salmonella typhimurium; komórki grzybów takich, jak drożdże; komórki owadzie takie, jak Drosophilia S2 i Spodoptera Sf9; komórki zwierzęce takie, jak CHO, COS lub Bowes melanoma; adenowirusy; oraz komórki roślinne (patrz również dyskusja powyżej). Wybór odpowiedniego gospodarza dla rekombinacji i/lub redukcyjnej reasortacji czy tylko do ekspresji rekombinowanego białka uważa się za objęty zakresem znawców w tej dziedzinie na podstawie zamieszczonego tu opisu. Układy hodowli komórek ssaków, które można wykorzystać do rekombinacji i/lub redukcyjnej reasortacji lub po prostu do ekspresji rekombinowanego białka obejmują, np. linie COS-7 fibroblastów nerki małpy, opisane w ?SV40-transformed simian cells support the replication of early SV40 mutants? (Gluzman, 1981), linie komórkowe C127, 3T3, CHO, HeLa i BHK. Ssacze wektory ekspresyjne mogą zawierać miejsce inicjacji replikacji, odpowiedni promotor i wzmacniacz, i niezbędne miejsca wiązania rybosomu, miejsce poliadenylacji, miejsca dawcy i akceptora splicingu, sekwencje terminacji transkrypcji i 5' flankujące nietranskrybowane sekwencje. Sekwencje DNA pochodzące z miejsc splicingowych, i poliadenylacji SV40 mogą być wykorzystane w celu zapewnienia wymaganych nietranskrybowanych elementów genetycznych. [0370] Komórki gospodarza zawierające przedmiotowe polinukleotydy (do rekombinacji i/lub redukcyjnej reasortacji lub po prostu do ekspresji rekombinowanego białka) można hodować w konwencjonalnych pożywkach odżywczych, odpowiednio modyfikowanych do aktywowania promotorów, selekcji transformantów lub amplifikacji genów. Warunki hodowli takie, jak temperatura, pH i podobne, są tymi stosowanymi wcześniej dla komórki gospodarza wybranej do ekspresji, i będą oczywiste dla znawcy. Klony, które zostaną zidentyfikowane jako mające specyficzną aktywność enzymatyczną, można następnie sekwencjonować, w celu zidentyfikowania sekwencji polinukleotydowej kodującej enzym o podwyższonej aktywności. [0371] W innym aspekcie, kwasy nukleinowe i sposoby według niniejszego wynalazku można stosować w celu wygenerowania nowych polinukleotydów dla szlaków biochemicznych, np. szlaków z jednego lub więcej operonów lub klastrów genów lub ich części. Na przykład, bakterie i wiele eukariontów ma skoordynowany mechanizm do regulacji genów, których produkty są zaangażowane w powiązane procesy. Geny tworzą klastry, w -120- strukturach nazywanych ?klastrami genów? na pojedynczym chromosomie i są transkrybowane razem, pod kontrolą pojedynczej sekwencji regulatorowej, w tym pojedynczego promotora, który inicjuje transkrypcję całego klastra. Zatem klaster genów oznacza grupę sąsiadujących genów, które są identyczne lub powiązane, zazwyczaj co do ich funkcji. [0372] DNA genów klastra można izolować z różnych organizmów i poddać ligacji do wektora, szczególnie wektorów ekspresyjnych zawierających sekwencje regulatorowe, które można kontrolować i regulować produkcję wykrywalnego białka lub aktywności białka związanego z macierzą z ligowanych klastrach genów. Zastosowanie wektorów, które mają wyjątkowo dużą zdolność do wprowadzenia egzogennego DNA są szczególnie odpowiednie do stosowania w takich grupach genów i są opisane przykładowo w niniejszym dokumencie, obejmują czynnik f (lub współczynnik płodności) z E. coli. Ten czynnik f z E. coli to plazmid, który wpływa na przenoszenie dużej częstotliwości siebie podczas koniugacji i jest idealny do osiągnięcia i stabilnej propagacji dużych fragmentów DNA takich, jak grupy genów z próbek drobnoustrojów mieszanych. ?Fosmidy?, kosmidy lub wektory sztuczne chromosomy bakteryjne (BAC) mogą być użyte jako wektory do klonowania. Pochodzą one z czynnika f E. coli, który jest zdolny do stabilnej integracji dużych odcinków DNA genomowego. Podczas integracji DNA z niehodowanej mieszanej próbki środowiskowej, umożliwia to osiągnięcie dużych fragmentów genomowego DNA w postaci stabilnej ?środowiskowej biblioteki DNA?. Wektory kosmidowe były pierwotnie zaprojektowane do klonowania i propagacji dużych odcinków DNA genomowego. Klonowanie do wektorów kosmidowych opisano szczegółowo w Sambrook i wsp., Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press (1989). Po ligacji do odpowiedniego wektora do odpowiedniej komórki gospodarza można wprowadzić dwa lub więcej wektorów zawierających różne klastry genów syntazy poliketydowej. Obszary częściowej homologii sekwencji dzielonej przez klastry genów będą wspierać procesy, które dają reorganizacji sekwencji w hybrydowym klastrze genów. Nowy hybrydowy klaster genów można następnie przesiewać pod kątem rozszerzonych działań, które nie znajdują się w oryginalnych klastrach genów. [0373] Zatem, w jednym aspekcie, ujawnienie dotyczy sposobu wytwarzania biologicznie aktywnego hybrydowego polipeptydu z użyciem kwasu nukleinowego według wynalazku i przesiewania polipeptydu pod kątem aktywności (np. zwiększona aktywność) poprzez: (1) wprowadzenie co najmniej pierwszego polinukleotydu (np. kwas nukleinowy według wynalazku) w funkcjonalnym połączeniu i drugiego polinukleotydu w funkcjonalnym połączeniu, przy czym wymieniony co najmniej pierwszy polinukleotyd i drugi polinukleotyd dzielą co najmniej jednego region częściowej homologii, do odpowiedniej komórki gospodarza; (2) hodowanie komórki gospodarza w warunkach, które promują reorganizację sekwencji dając hybrydowy polinukleotyd w funkcjonalnym połączeniu; (3) ekspresja hybrydowego polipeptydu kodowanego przez hybrydowy polinukleotyd; -121- (4) przesiewanie hybrydowego polipeptydu w warunkach, które promują określenie pożądanej aktywności biologicznej (np. zwiększonej aktywności fosfolipazy); i (5) izolowanie polinukleotydu kodującego hybrydowy polipeptydu. [0374] Metody badań przesiewowych do różnych aktywności enzymów są dobrze znane znawcom w dziedzinie i są omówione w niniejszym opisie. Metody te mogą być stosowane przy izolacji polipeptydów i polinukleotydów według wynalazku. [0375] Reasortacja in vivo koncentruje się na procesach ?międzycząsteczkowych?, zbiorczo określanych jako ?rekombinacja?. W bakteriach jest ogólnie postrzegana jako zjawisko ?zależne od RecA?. Ujawnienie może polegać na procesach rekombinacji komórki gospodarza do rekombinacji i reasortacji sekwencji, lub zdolności komórek do pośredniczenia w procesach redukujących w celu zmniejszenia złożoności sekwencji quasi powtarzanych w komórce przez delecję. Proces ten ?redukcyjnej reasortacji? następuje przez ?wewnątrzcząsteczkowy?, zależny od RecA proces. Zatem, w jednym aspekcie według ujawnienia, z użyciem kwasów nukleinowych według wynalazku, wytwarza się nowe polinukleotydy w procesie redukcyjnej reasortacji. Sposób obejmuje wytworzenie konstruktów zawierających kolejne sekwencje (oryginalne sekwencje kodujące), ich wprowadzenie do odpowiedniego wektora, a następnie ich wprowadzenie do odpowiedniej komórki gospodarza. Reasortacja poszczególnych tożsamości molekularnych występuje w procesach kombinatorycznych pomiędzy kolejnymi sekwencjami w konstrukcie mającym regiony homologii, lub pomiędzy jednostkami quasi-powtórzonymi. Proces reasortacji rekombinuje i/lub redukuje złożoność i zakres powtarzanych sekwencji i prowadzi do produkcji nowych rodzajów cząsteczek. [0376] Różne obróbki mogą być stosowane w celu zwiększenia szybkości reasortacji. Mogą to być traktowanie światłem ultrafioletowym lub środkami chemicznymi uszkadzającymi DNA i/lub z wykorzystaniem linii komórek gospodarza wykazujących ulepszone wartości ?niestabilności genetycznej?. Tak więc proces reasortacji może obejmować homologiczną rekombinację lub naturalną właściwość sekwencji quasi powtarzanych do kierować ich własną ewolucją. [0377] Sekwencje powtarzane lub ?quasi powtarzane? odgrywają rolę w niestabilności genetycznej. ?Quasi powtórzenia? są powtórzeniami, które nie są ograniczone są do ich pierwotnej struktury jednostki. Quasi-powtarzane jednostki mogą być przedstawione w macierzy sekwencji w konstrukcie; kolejne jednostki podobnych sekwencji. Po ligacji, połączenia między kolejnymi sekwencjami stają się zasadniczo niewidoczne i charakter quasi-powtarzalny uzyskanego konstruktu jest obecnie ciągły na poziomie molekularnym. Proces usuwania komórek prowadzący do zmniejszenia złożoności uzyskanego konstruktu obowiązuje między sekwencjami quasi-powtarzanymi. Jednostki quasi-powtórzone zapewniają praktycznie nieograniczony repertuar matryc, na których mogą wystąpić zdarzenia poślizgu. Konstrukty zawierające quasi powtórzenia w ten sposób skutecznie zapewniają taką wystarczającą elastyczność molekularną, że zdarzenia delecji (i potencjalnie wstawiania) mogą wystąpić praktycznie w dowolnym miejscu jednostek quasi-powtarzane. -122- Kiedy sekwencje quasi powtarzane są ligowane w tej samej orientacji, na przykład głowa do ogona lub odwrotnie, komórka nie może rozróżnić poszczególnych jednostek. W związku z tym proces redukcyjny może wystąpić w całej sekwencji. W przeciwieństwie do tego, gdy na przykład, jednostki są przedstawiane głowa do głowy, zamiast głowy do ogona, inwersja wyznacza punkty końcowe sąsiedniej jednostki tak, że tworzenie delecji sprzyjać będzie utracie odrębnych jednostek. Tak więc, w jednym aspekcie według ujawnienia, sekwencje mają być reasortowane w tej samej orientacji. Losowa orientacja sekwencji quasi powtarzanych spowoduje utratę wydajności reasortacji, natomiast spójna orientacja sekwencji zaoferuje najwyższą wydajność. Jednakże, choć posiadanie mniejszej liczby ciągłych sekwencji w tej samej orientacji zmniejsza efektywność, nadal można zapewnić wystarczającą elastyczność dla skutecznego odzyskania nowych cząsteczek. Konstrukty mogą być wykonane z sekwencjach quasi powtarzanych w tej samej orientacji, aby umożliwić wyższą skuteczność. [0378] Sekwencje mogą być łączone w orientacji głowa do ogona za pomocą dowolnego z wielu różnych sposobów, w tym następujących: a) Można wykorzystać startery, które zawierają głowę poli-A i ogon poli-T, które gdy wykonane jako jednoniciowe, zapewniłyby orientację. Jest to osiągnięte poprzez kilka pierwszych zasad starterów wykonanych z RNA, a więc łatwo usuwalnych dzięki RNazie H. b) Można wykorzystać startery, które zawierają pojedyncze miejsca cięcia restrykcyjnego. Wymagane mogą być wielokrotne miejsca, baterie unikalnych sekwencji i powtarzające się etapy syntezy i ligacji. c) Kilka wewnętrznych zasad startera można tiolować i wykorzystywać egzonukleazę do produkcji cząsteczek prawidłowo skrojonych. [0379] Odzyskiwanie reasortowanych sekwencji polega na identyfikacji wektorów klonujących ze zmniejszonym wskaźnikiem powtarzalności (RI). Reasortowane sekwencje kodujące następnie można odzyskać przez amplifikację. Produkty ponownie klonuje się i eksprymuje. Na odzyskiwanie wektorów klonujących o zmniejszonym RI można wpływać przez: 1) Zastosowanie wektorów tylko trwale utrzymywanych, gdy konstrukt ma zredukowaną złożoność. 2) Fizyczne odzyskiwanie skróconych wektorów procedurami fizycznymi. W tym przypadku, wektor do klonowania można by odzyskać za pomocą standardowych procedur izolacji plazmidu i poddania frakcjonowaniu wielkości na żelu agarozowym lub kolumnie o niskiej masie cząsteczkowej odcięcia z wykorzystaniem standardowych procedur. 3) Odzyskiwanie wektorów zawierających geny przerwane, które można poddać selekcji, gdy spada wielkość wstawki. 4) Stosowanie bezpośrednich metod selekcji z zastosowaniem wektora ekspresyjnego i odpowiedniej selekcji. [0380] Sekwencje kodujące (na przykład, geny) z organizmów pokrewnych mogą wykazać wysoki stopień homologii i kodować dość różnorodne produkty białkowe. Te typy sekwencji są szczególnie użyteczne w niniejszym ujawnieniu jako quasi powtórzenia. Jednakże proces ten nie jest ograniczony do takich prawie identycznych powtórzeń. [0381] Poniższy przykład ilustruje sposób według ujawnienia. Kodujące sekwencje kwasu nukleinowego (quasi-powtórzenia) pochodzą z trzech (3) gatunków, w tym kwas nukleinowy według ujawnienia. Każda sekwencja koduje białko o odrębnym zestawie właściwości, w tym -123- enzym według wynalazku. Każda z sekwencji różni się od jednej lub kilku par zasad w unikalnej pozycji w sekwencji. Sekwencje quasi powtarzane są oddzielane lub wspólnie amplifikowane i ligowane do losowych zespołów tak, że dostępne są wszystkie możliwe permutacje i kombinacje w populacji ligowanych cząsteczek. Liczba quasi powtarzanych jednostek może być kontrolowana warunkami składania. Średnia liczba jednostek quasi powtarzanych w konstrukcie jest zdefiniowana jako wskaźnik powtarzalności (RI). Po wytworzeniu, konstrukty mogą lub nie mogą być frakcjonowane pod względem wielkości w żelu agarozowym, zgodnie z opublikowanymi protokołami, wstawiane do wektora do klonowania i transfekowane do odpowiedniej komórki gospodarza. Następnie komórki są rozmnażane i następuje ?redukcyjna reasortacja?. Szybkość procesu redukcyjnej reasortacji może być stymulowany przez wprowadzenie uszkodzeń DNA, jeśli jest to pożądane. Nie ma znaczenia to, czy zmniejszenie RI odbywa się za pośrednictwem tworzenia delecji między powtarzanymi sekwencjami za pomocą mechanizmu ?wewnątrzcząsteczkowego?, czy za pośrednictwem zdarzeń podobnych do rekombinacji poprzez mechanizm ?międzycząsteczkowy?. Wynik końcowy jest reasortacją cząsteczek we wszystkich możliwych kombinacjach. W jednym aspekcie, sposób obejmuje dodatkowy etap odsiewania członków biblioteki przetasowanej puli celem identyfikacji poszczególnych elementów przetasowanej biblioteki mających zdolność do wiązania lub w inny sposób oddziaływania, lub katalizowania określonej reakcji (np. tak, jak domena katalityczna enzymu) uprzednio określoną makrocząsteczką taką, jak na przykład receptor białkowy, ligosacharyd, wirion, lub inny góry określony związek lub struktura. Polipeptydy, np. fosfolipazy, które są identyfikowane z takich bibliotek, można wykorzystywać do różnych celów, np. opisane tu procesy przemysłowe i/lub można poddać jednemu lub większej liczbie dodatkowych cykli tasowania i/lub selekcji. [0382] Można sobie wyobrazić, że przed lub podczas rekombinacji lub reasortacji, polinukleotydy wytworzone sposobem według ujawnienia można poddać środkom lub procesom, które promują wprowadzenie mutacji do oryginalnych polinukleotydów. Wprowadzenie takich mutacji zwiększyłoby różnorodność uzyskanych hybrydowych polinukleotydów i polipeptydów z nich kodowanych. Środki lub procesy, które promują mutagenezę mogą obejmować, ale nie są do nich ograniczone: (+)-CC-1065, lub syntetyczne analogi takie, jak (+)-CC-1065-(N3-Adenina (Patrz Sun i Hurley, (1992); N-acetylowany lub deacetylowany 4'-fluro-4-aminobifenylowy addukt zdolny do hamowania syntezy DNA (Patrz, na przykład, van de Poll i wsp. (1992)); albo N-acetylowany lub deacetylowany 4aminobifenylowy addukt zdolny do hamowania syntezy DNA (Patrz także, van de Poll i wsp. (1992), str. 751-758); trójwartościowy chrom, sole trójwartościowego chromu, addukt DNA z policyklicznymi węglowodorami aromatycznymi (PAH) zdolny do hamowania replikacji DNA takimi, jak 7-bromometylo-benz[a]antracen (?BMA?), tris(2,3dibromopropylo)fosforan (?Tris-BP?), 1,2-dibromo-3-chloropropan (?DBCP?), 2bromoakroleina (2BA), benzo[a]pireno-7,8-dihydrodiol-9-10-epoksyd (?BPDE?), sole halogenkowe platyny (II), N-hydroksy-2-amino-3-metyloimidazo[4,5-f]-chinolina (?Nhydroksy-IQ?), i N-hydroksy-2-amino-1-metylo-6-fenyloimidazo[4,5-f]-pirydyna (?Nhydroksy-PhIP?). Szczególnie korzystne środki spowalniające lub zatrzymujące amplifikację -124- PCR składają się ze światła UV (+)-CC-1065 i (+)-CC-1065-(N3-Adenina). Szczególnie objętymi środkami są addukty DNA lub polinukleotydów obejmujące addukty DNA z pulą polinukleotydów lub polinukleotydów, które mogą być uwalniane lub usuwane w procesie obejmującym ogrzewanie roztworu zawierającego polinukleotydy przed dalszym przetwarzaniem. Metodologie Badań Przesiewowych i Urządzenia Monitorujące ?On-Line? [0383] W praktykowaniu sposobów według ujawnienia w opisie można stosować szereg urządzeń i metodologii, w połączeniu z polipeptydami i kwasami nukleinowymi według wynalazku, np. do badań przesiewowych polipeptydów pod kątem aktywności fosfolipazy, do badań przesiewowych związków jako potencjalnych modulatorów aktywności (np. wzmocnienie lub inhibicja aktywności enzymu), przeciwciał, które wiążą się z polipeptydem według wynalazku, kwasów nukleinowych, które hybrydyzują do kwasów nukleinowych według wynalazku, i podobnych. Unieruchamianie Enzymów na Stałych Nośnikach [0384] Enzymy fosfolipazy, ich fragmenty i kwasy nukleinowe, które kodują enzymy i fragmenty można unieruchomić na stałym nośniku. Jest to często ekonomiczne i skuteczne przy stosowaniu fosfolipaz w procesach przemysłowych. Na przykład, zespół lub koktajl enzymów fosfolipazy (lub ich aktywnych fragmentów), które są stosowane w specyficznej reakcji chemicznej, można przyłączyć do stałego nośnika i zanurzyć w zbiorniku procesowym. Może dojść do reakcji enzymatycznej. Następnie, stały nośnik można wyjąć ze zbiornika, wraz z dołączonymi do niego enzymami, do powtarzanego użytku. W jednym przykładzie wykonania według ujawnienia, izolowany kwas nukleinowy według ujawnienia mocuje się do stałego nośnika. W innym przykładzie wykonania, nośnik jest wybrany z grupy żelu, żywicy, polimeru, materiału ceramicznego, szkła, mikroelektrody i dowolnej ich kombinacji. [0385] Na przykład, stałe nośniki użyteczne w niniejszym wynalazku obejmują żele. Niektóre przykłady żeli obejmują Sepharose, żelatynę, glutaraldehyd, glutaraldehyd traktowany chitosanem, albuminę-glutaraldehyd, chitosan-Xanthan, żel toyopearl (żel polimerowy), alginian, alginian-polilizynę, karageninę, agarozę, agarozę glioksalową, agarozę magnetyczną, dekstran, agarozę, hydrożel poli(karbamoilo-sulfonowy), hydrożel BSA-PEG, fosforylowany alkohol poliwinylowy (PVA), mono-aminoetylo-N-aminoetylo (MANA), amino, lub ich dowolną kombinację. [0386] Innym stałym nośnikiem użytecznym w niniejszym ujawnieniu są żywice lub polimery. Niektóre przykłady żywic lub polimerów obejmują celulozę, akryloamid, nylon, sztuczny jedwab, poliester, żywicę anionowymienną, AMBERLITE? XAD-7, AMBERLITE? XAD-8, AMBERLITE? IRA-94, AMBERLITE? IRC-50, poliwinyl, poliakrylan, polimetakrylan, lub ich dowolną kombinację. [0387] Innym rodzajem stałego nośnika użytecznego w niniejszym ujawnieniu jest materiał ceramiczny. Niektóre przykłady obejmują, nieporowaty materiał ceramiczny, porowaty materiał ceramiczny, SiO2, Al2O3. Innym rodzajem stałego nośnika użytecznym w niniejszym -125- ujawnieniu jest szkło. Niektóre przykłady obejmują szkło nieporowate, szkło porowate, szkło aminopropylowe lub dowolną ich kombinację. Innym rodzajem stałego nośnika, który może być używany, jest mikroelektroda. Przykładem jest magnetyt pokryty polietylenoiminą. Cząstki grafitu mogą być stosowane jako stały nośnik. [0388] Inne przykładowe stałe nośniki wykorzystywane do praktykowania ujawnienia obejmują produkty ziemi okrzemkowej i krzemiany. Niektóre przykłady obejmują diatomity CELITE? KENITE?, DIACTIV?, PRIMISIL?, DIAFIL? i syntetyczne krzemiany wapnia i magnezu MICRO-CEL?, CALFLO?, SILASORB?, i CELKATE?. Innym przykładem stałego nośnika jest komórka taka, jak krwinka czerwona. Sposoby unieruchamiania [0389] Jest wiele sposobów, które będą znane znawcy, do unieruchamiania enzymów lub ich fragmentów, lub kwasów nukleinowych, na nośniku. Niektóre przykłady takich sposobów obejmują, np. generowanie kropli elektrostatycznej, sposoby elektrochemiczne, adsorpcję, wiązanie kowalencyjne, sieciowanie, reakcję chemiczną lub proces, kapsułkowanie, pułapkowanie, alginian sodu, lub poli (2-hydroksyetylometakrylan). Podobne sposoby opisano w Methods in Enzymology, Immobilized Enzymes and Cells, Part C. 1987. Academic Press. Podredakcją S. P. Colowick i N. O. Kaplan. Tom 136; i Immobilization of Enzymes and Cells. 1997. Humana Press. Pod redakcją G. F. Bickerstaff. Series: Methods in Biotechnology, pod redakcją J. M. Walker. Macierze Kapilarne [0390] Macierze kapilarne, jak GIGAMATRIX?, Diversa Corporation, San Diego, CA; można stosować w sposobach według ujawnienia. Kwasy nukleinowe lub polipeptydy według wynalazku można unieruchamiać lub nanosić na macierz. Macierze można stosować do przesiewania dla lub monitorowania bibliotek kompozycji (np. małych cząsteczek, przeciwciał, kwasów nukleinowych, itd.) w kierunku ich zdolności do wiązania się lub modulowania aktywności kwasu nukleinowego lub polipeptydu według wynalazku. Macierze kapilarne zapewniają inny system do przechowywania i przesiewania próbek. Na przykład, urządzenie do badania przesiewowego próbki może obejmować wiele kapilar tworzących macierz przyległych kapilar, przy czym każda kapilara ma co najmniej jedną ścianę wyznaczającą prześwit dla utrzymania próbki. Urządzenie może dodatkowo zawierać materiał międzywęzłowy usytuowany pomiędzy sąsiednimi kapilarami w macierzy i jedno lub więcej oznaczeń odniesienia utworzonych w obrębie materiału międzywęzłowego. Kapilara dla przesiewania próbki, przy czym kapilara jest przystosowana do wiązania się w macierzy kapilarnej, może zawierać pierwszą ściankę wyznaczającą prześwit dla utrzymania próbki i drugą ściankę wykonaną z materiału filtracyjnego, dla sączenia energii wzbudzenia dostarczonej do prześwitu aby wzbudzić próbkę. [0391] Polipeptyd lub kwas nukleinowy, np. ligand można wprowadzić do pierwszego składnika do co najmniej części kapilary macierzy kapilarnej. Każda kapilara macierzy kapilarnej może zawierać co najmniej jedną ściankę wyznaczającą prześwit dla utrzymywania pierwszego składnika. Pęcherzyk powietrza można wprowadzić do kapilary za pierwszym -126- składnikiem. Do kapilary może być wprowadzony drugi składnik, przy czym drugi składnik jest oddzielony od pierwszego składnika przez pęcherzyk powietrza. Próbkę będącą przedmiotem zainteresowania można wprowadzić jako pierwszą ciecz wyznakowaną wykrywalną cząstką do kapilary macierzy kapilarnej, przy czym każda kapilara macierzy kapilarnej zawiera co najmniej jedną ściankę wyznaczającą prześwit dla utrzymania pierwszej cieczy i wykrywalnej cząstki, i przy czym co najmniej jedną ściankę powleka się materiałem wiążącym dla wiązania wykrywalnej cząstki do co najmniej jednej ścianki. Sposób ten może ponadto obejmować usunięcie pierwszej cieczy z rurki kapilarnej, przy czym związana cząstka wykrywalna jest utrzymywana wewnątrz kapilary i wprowadzenie drugiej cieczy do rurki kapilarnej. [0392] Macierz kapilarna może zawierać wiele indywidualnych kapilar zawierających co najmniej jedną ścianę wyznaczającą prześwit. Zewnętrzna ściankę kapilary może stanowić jedna lub większa liczba stopionych ścianek. Podobnie, ścianka może określać prześwit, który jest cylindryczny, kwadratowy, sześciokątny lub inny dowolny geometryczny kształt, o ile ścianki tworzą prześwit dla zatrzymywania cieczy i próbki. Kapilary macierzy kapilarnej mogą być utrzymywane ze sobą w bliskim sąsiedztwie, tworząc strukturę płaską. Kapilary mogą być połączone ze sobą, przez stopienie (np. gdy kapilary są wykonane ze szkła), sklejone, połączone lub zaciśnięte jedna obok drugiej. Macierz kapilarna może być wykonana z dowolnej liczby indywidualnych kapilar, na przykład, w zakresie od 100 do 4,000,000 kapilar. Macierz kapilarna może tworzyć płytkę do mikromiareczkowania mającą około 100,000 lub więcej indywidualnych kapilar połączonych razem. Macierze lub ?BioChip? [0393] Kwasy nukleinowe lub polipeptydy według wynalazku mogą być unieruchamiane lub nanoszone na macierz. Macierze można stosować do badań przesiewowych lub do monitorowania bibliotek kompozycji (np. małych cząsteczek, przeciwciał, kwasów nukleinowych itd.) pod kątem ich zdolności do wiązania się z lub modulowania aktywności kwasu nukleinowego lub polipeptydu według wynalazku. Na przykład, w jednym aspekcie według ujawnienia, monitorowanym parametrem jest ekspresja transkryptu genu fosfolipazy. Jeden lub więcej, lub, wszystkie transkrypty komórki można zmierzyć poprzez hybrydyzację próbki zawierającej transkrypty komórki, lub, kwasy nukleinowe reprezentatywne lub komplementarne do transkryptów komórki, przez hybrydyzację do unieruchomionych kwasów nukleinowych na macierzy, lub ?bioczipie?. Przez stosowanie ?macierzy? kwasów nukleinowych na mikroczipie, niektóre lub wszystkie z tych transkryptów komórki można równocześnie oznaczać ilościowo. Alternatywnie, macierze zawierające genomowy kwas nukleinowy można także wykorzystać do określenia genotypu nowo zmodyfikowanego technikami inżynierii szczepu wykonanego według ujawnienia. Polipeptydowe macierze? można być również stosować do jednoczesnego ilościowego oznaczania wielu białek. [0394] Niniejsze ujawnienie można praktykować na dowolnej znanej ?macierzy? również nazywanej ?mikromacierzą? lub ?macierzą kwasu nukleinowego? lub ?macierzą polipeptydu? lub ?macierzą przeciwciał? lub ?biochipem? lub ich wariacją. Macierze stanowią rodzajowo szereg ?punktów? lub ?elementów docelowych? każdy element docelowy zawiera określoną -127- ilość jednej lub więcej cząsteczek biologicznych, np. oligonukleotydów, unieruchamianych na zdefiniowanym obszarze powierzchni substratu, do specyficznego wiązania się do próbki cząsteczki, np. transkryptów mRNA. [0395] W praktykowaniu sposobów według ujawnienia można wprowadzać dowolną znaną macierz i/lub sposób wytwarzania oraz stosowania macierzy, w całości lub w części, lub ich wariacje, jak to opisano, na przykład, w Patentach US Nry 6,277,628; 6,277,489; 6,261,776; 6,258,606; 6,054,270; 6,048,695; 6,045,996; 6,022,963; 6,013,440; 5,965,452; 5,959,098; 5,856,174; 5,830,645; 5,770,456; 5,632,957; 5,556,752; 5,143,854; 5,807,522; 5,800,992; 5,744,305; 5,700,637; 5,556,752; 5,434,049; patrz także, np. WO 99/51773; WO 99/09217; WO 97/46313; WO 96/17958; patrz także, np. Johnston (1998) Curr. Biol. 8:R171-R174; Schummer (1997) Biotechniques 23:1087-1092; Kern (1997) Biotechniques 23:120-124; Solinas-Toldo (1997) Genes, Chromosomes & Cancer 20:399-407; Bowtell (1999) Nature Genetics Supp. 21:25-32. Patrz także opublikowane zgłoszenia patentowe US nry 20010018642; 20010019827; 20010016322; 20010014449; 20010014448; 20010012537; 20010008765. Przeciwciała i oparte na Przeciwciałach sposoby do badań przesiewowych [0396] Ujawnienie zapewnia wyizolowane lub rekombinowane przeciwciała, które specyficznie wiążą się z fosfolipazą według wynalazku. Te przeciwciała można stosować do izolacji, identyfikacji lub określania ilościowego fosfolipaz według wynalazku lub powiązanych polipeptydów. Te przeciwciała można stosować do hamowania aktywności enzymu ujawnionego w opisie. Te przeciwciała można stosować do izolacji polipeptydów powiązanych z tymi według wynalazku, np. powiązanych enzymów fosfolipaz. Przeciwciała te mogą być stosowane w immunoprecypitacji, barwieniu (np. FACS), kolumnach immunopowinowactwa i podobnych. Jeśli jest to pożądane, sekwencje kwasów nukleinowych kodujące specyficzne antygeny mogą być generowane przez immunizację, a następnie izolację polipeptydu lub kwasu nukleinowego, amplifikację lub klonowanie i unieruchomienie polipeptydu na macierzy według ujawnienia. Alternatywnie, te sposoby według ujawnienia mogą być stosowane do modyfikowania struktury przeciwciała wytwarzanego przez komórki, które mają zostać zmodyfikowane, np. można zwiększyć lub zmniejszyć powinowactwo przeciwciała. Ponadto, możliwość wytwarzania lub modyfikowania przeciwciał może być modyfikowana fenotypowo metodami inżynierii do komórki tymi sposobami według ujawnienia. [0397] Sposoby immunizacji wytwarzania i izolacji przeciwciał (poliklonalnych i monoklonalnych) są dobrze znane znawcom w tej dziedzinie i opisane w literaturze naukowej i patentowej, patrz, np. Coligan, CURRENT PROTOCOLS IN IMMUNOLOGY, Wiley/Greene, NY (1991); Stites (eds.) BASIC AND CLINICAL IMMUNOLOGY (7th ed.) Lange Medical Publications, Los Altos, CA (?Stites?); Goding, MONOCLONAL ANTIBODIES: PRINCIPLES AND PRACTICE (2d ed.) Academic Press, New York, NY (1986); Kohler (1975) Nature 256:495; Harlow (1988) ANTIBODIES, A LABORATORY MANUAL, Cold Spring Harbor Publications, New York. Przeciwciała mogą być również -128- generowane in vitro, np. zastosowanie bibliotek prezentacji na fagu z ekspresją miejsca wiążącego zrekombinowanego przeciwciała, obok tradycyjnych metod in vivo z wykorzystaniem zwierząt w. Patrz, np. Hoogenboom (1997) Trends Biotechnol. 15:62-70; Katz (1997) Annu. Rev. Biophys. Biomol. Struct. 26:27-45. [0398] Polipeptydy można stosować w celu wygenerowania przeciwciał, które specyficznie wiążą się z polipeptydami według wynalazku. Powstałe przeciwciała mogą być stosowane w procedurach chromatografii immunopowinowactwa, do izolacji lub oczyszczania polipeptydu, lub do określenia czy polipeptyd jest obecny w próbce biologicznej. W takich procedurach preparat białkowy taki, jak ekstrakt, lub próbka biologiczna są kontaktowane z przeciwciałem zdolnym do wiązania się specyficznie z jednym z polipeptydów według wynalazku. [0399] W procedurach immunopowinowactwa, przeciwciała są przyłączone do stałego nośnika takiego, jak perełki, lub innej matrycy kolumny. Preparat białkowy umieszcza się w styczności z przeciwciałem w warunkach, w których przeciwciało wiąże się specyficznie do jednego z polipeptydów wynalazku. Po przemyciu w celu usunięcia niespecyficznie związanych białek, specyficznie związane polipeptydy wymywa się. [0400] Zdolność białek w próbce biologicznej do wiązania się z przeciwciałem można określać przy użyciu dowolnej z różnych procedur znanych znawcom w tej dziedzinie. Na przykład, wiązanie można określić poprzez znakowanie przeciwciała wykrywalnym znacznikiem takim, jak środek fluorescencyjny, znacznik enzymatyczny lub radioizotop. Alternatywnie, wiązanie przeciwciała z próbką można wykrywać przy użyciu drugorzędowego przeciwciała mającego na sobie taki wykrywalny znacznik. Poszczególne testy obejmują testy ELISA, testy kanapkowe, testy radioimmunologiczne i Western bloty. [0401] Poliklonalne przeciwciała wytworzone przeciwko polipeptydom według wynalazku można uzyskać poprzez bezpośrednie wstrzyknięcie polipeptydów do zwierzęcia lub przez podawanie polipeptydów zwierzęciu, na przykład, innemu niż człowiek. Otrzymane w ten sposób przeciwciało będzie wiązać się sam polipeptyd. W ten sposób, nawet sekwencję kodującą tylko fragment polipeptydu można stosować do wytwarzania przeciwciał, które mogą wiązać się z całym polipeptydem natywnym. Takie przeciwciała mogą być następnie stosowane do izolowania polipeptydu z komórek z ekspresją tego polipeptydu. [0402] Do wytwarzania przeciwciał monoklonalnych, można stosować każdą technikę, która dostarcza przeciwciała produkowanego przez ciągłą hodowlę linii komórkowej. Przykłady obejmują technikę hybrydomy, technikę triomy, technikę hybrydomy ludzkich komórek B oraz technikę EBV-hybrydoma (patrz, np. Cole (1985) w Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., str. 77-96). [0403] Techniki opisane do wytwarzania przeciwciał jednołańcuchowych (patrz, np. Patent US Nr 4,946,778) można dostosować do wytwarzania przeciwciał jednołańcuchowych do polipeptydów według wynalazku. Alternatywnie, transgeniczne myszy mogą być stosowane do ekspresji humanizowanych przeciwciał do tych polipeptydów lub ich fragmentów. -129- [0404] Przeciwciała generowane przeciwko polipeptydom według wynalazku mogą być stosowane w badaniu przesiewowym, w poszukiwaniu podobnych polipeptydów z innych organizmów i próbek. W takich technikach polipeptydy z organizmu są kontaktowane z przeciwciałem i wykrywa się te polipeptydy, które specyficznie wiążą przeciwciało. Można stosować dowolne z procedur opisanych powyżej do wykrywania wiązania przeciwciał. Zestawy [0405] Ujawnienie zapewnia zestawy zawierające kompozycje, np. kwasy nukleinowe, kasety ekspresyjnej, wektory, komórki, polipeptydy (np. zestaw z co najmniej jedną fosfolipazą według wynalazku) i/lub przeciwciała (np. zestaw z co najmniej jednym przeciwciałem według ujawnienia. Zestawy mogą również zawierać materiały instruktażowe, prezentujące metodologię i zastosowania przemysłowe według ujawnienia, jak tu opisane. Przemysłowe i Medyczne Zastosowania Enzymów według Wynalazku [0406] Ujawnienie zapewnia wiele przemysłowych zastosowań i aplikacji medycznych wykorzystujących polipeptydy według wynalazku, np. fosfolipazę i inne enzymy według wynalazku, np. fosfolipazy A, B, C i D, patatyny, w tym przekształcanie nieulegającego uwodnieniu fosfolipidu do postaci ulegającej uwodnieniu, odśluzowywanie oleju, przetwarzanie olejów z roślin, ryb, glonów i podobne, by wymienić tylko kilka aplikacji. W dowolnym z tych alternatywnych zastosowań przemysłowych i aplikacji medycznych enzymy można dodawać w określonej kolejności, np. fosfolipazy o odmiennej specyfice dodaje się w określonej kolejności, na przykład, enzym o aktywności hydrolizowania PC- i PE jest dodawany jako pierwszy (lub dodaje się dwa enzymy, jeden o aktywności hydrolizowania PC- i drugi o aktywności hydrolizowania PE), następnie dodawany jest enzym o aktywności hydrolizowania PI (np. aktywność PLC) lub dowolne ich kombinacje. [0407] Można stosować według wynalazku dowolne lub wszystkie sposoby na ?skalę procesu?, np. przetwarzanie oleju lub rafinowanie na skalę od około 15,000; 25,000; 50,000; 75,000; lub 100,000 funtów oleju rafinowanego/dziennie aż do około 1, 2, 3, 4, 5 lub 6 lub więcej milionów funtów oleju rafinowanego/dziennie. [0408] Sposoby stosowania enzymów fosfolipazy w aplikacjach przemysłowych są dobrze znane ze stanu techniki. Na przykład, fosfolipazy i sposoby według wynalazku można stosować do obróbki tłuszczy i olejów jak opisano, np. w publikacji JP zgłoszenia patentowego H6-306386, opisującej przekształcanie fosfolipidów obecnych w olejach i tłuszczach do rozpuszczalnych w wodzie substancji zawierających grupy kwasu fosforowego. [0409] Fosfolipazy według wynalazku można stosować do przetwarzania olejów roślinnych i fosfolipidów takich, jak te pochodzące z lub izolowane z otrębów ryżowych, soi, rzepaku canola, palmy, nasion bawełny, kukurydzy, z ziaren palmowych, orzechów kokosowych, orzechów ziemnych, sezamu, słonecznika. Fosfolipazy według wynalazku można stosować do przetwarzania olejków eterycznych, np. tych z owoców nasion oleistych, np. z pestek winogron, moreli, ogórecznika itd. Fosfolipazy według wynalazku można stosować do przetwarzania olejów i fosfolipidów w różnych postaciach, w tym postaci surowej, odśluzowanej, substancji śluzowych, wody do przemywania, gliny, krzemionki, sopstoku, i -130- podobnych. Fosfolipidy według wynalazku można stosować do przetwarzania olejów wysokofosforowych, olejów rybnych, olejów zwierzęcych, olejów roślinnych, olejów z glonów i podobnych. W dowolnym aspekcie według wynalazku, dowolny moment, w którym można zastosować fosfolipazę C, alternatywa obejmuje stosowanie fosfolipazy D i fosfatazy (np. stosowanie kombinacji PLD/fosfataza do poprawienia wydajności w wysokofosforowym oleju, takim jak olej sojowy). [0410] Fosfolipazy według ujawnienia można stosować do przetwarzania i otrzymywania olejów jadalnych, olejów biodiesel, liposomów dla środków farmaceutycznych i kosmetyków, strukturyzowanych fosfolipidów i strukturyzowanych lipidów. Fosfolipazy według wynalazku można stosować w ekstrakcji oleju. Fosfolipazy według ujawnienia można stosować do przetwarzania i otrzymywania różnych mydeł. Przetwarzanie Olejów Jadalnych: Generowanie 1,3-diacyloglicerolu (1,3 DAG) [0411] Ujawnienie zapewnia sposoby wykorzystujące enzym(y) według wynalazku do otrzymywania 1,3-diacyloglicerolu (1,3-DAG). W jednym aspekcie, fosfolipaza C lub fosfolipaza D plus fosfataza generuje 1,2-diacyloglicerol; to poprawia wydajność oleju podczas rafinowania oleju jadalnego. Przy stosowaniu w sposobie, który zawiera etap kaustycznego zobojętnienia, na przykład jako pomoc w kaustycznym rafinowaniu, tyle co 70% 1,2-diacyloglicerydu (1,2-DAG) podlega przeniesieniu acylu i jest przekształcane do 1,3-DAG. 1,3-DAG posiada podwyższone korzyści zdrowotne i w konsekwencji stosowanie PLC jako pomocy w kaustycznym rafinowaniu daje olej o podwyższonej wartości odżywczej. [0412] Ujawnienie zapewnia sposoby, przy użyciu enzymu(-ów) według wynalazku do wytwarzania i przetwarzania olejów jadalnych, w tym generowania olejów jadalnych o podwyższonej ilości 1,3-DAG. Diacyloglicerole to naturalnie występujące związki znajdywane w wielu olejach jadalnych. W jednym aspekcie sposobu według wynalazku, np. w sposobie odśluzowywania oleju zasada (substancja żrąca) powoduje izomeryzację 1,2DAG, wyprodukowanego przez PLC, do 1,3-DAG, który zapewnia odżywcze korzyści zdrowotne względem 1,2-DAG, np. 1,3-DAG jest spalany jako energia, a nie odkładany jako tłuszcz (jak 1,2-DAG). Przez dodawanie PLC na początku sposobu rafinacji kaustycznej (a kwasu i substancji żrącej później), sposoby według wynalazku generują podwyższony poziom 1,3-DAG (obniżając poziom 1,2-DAG). Żywieniowo, 1,3-DAG jest lepszy dla spożywającego niż 1,2-DAG. W alternatywnych aspektach, wynalazek obejmuje sposób odśluzowywania oleju stosowanie PLC według wynalazku, dzięki któremu końcowy produkt oleju po odśluzowywaniu zawiera nie mniej niż około 0,5%, 1,0%, 2,0%, 3,0%, 4,0% lub więcej 1,3-DAG. [0413] Zatem ujawnienie zapewnia sposób wytwarzania (poprzez interestryfikację) oleju rafinowanego (np. oleju diacyloglicerolu), w tym olejów jadalnych, zawierających podwyższone poziomy 1,3-diacyloglicerolu (1,3-DAG), np. jak zilustrowano w Przykładzie 13, gdzie fosfolipaza taka, jak enzym według wynalazku, jest ?dodawana na starcie? lub dodawana przed dodawaniem kwasu lub sody kaustycznej. Generowanie DAG poprzez enzymatyczną hydrolizę z trójglicerydu poprzez interestryfikację powoduje powstawanie 1,3- -131- DAG z 1,2-DAG. Olej jadalny zawierający 1,3-DAG wykazuje różne oddziaływania metaboliczne w porównaniu do konwencjonalnych olejów jadalnych. Różnice w szlakach metabolicznych między 1,3-DAG i 1,2-DAG lub trójglicerydami powodują, że większa część kwasów tłuszczowych z 1,3-diacyloglicerolu jest spalana raczej jako energia, niż przechowywana jako tłuszcz. Badania kliniczne wykazały, że regularne spożywanie oleju DAG jako część rozsądnej diety pomaga jednostkom na regulowanie swojej masy ciała i poziomu tłuszczu w organizmie. Dodatkowo, metabolizm 1,3-DAG zmniejsza stężenie krążących w krwioobiegu po posiłku trójglicerydów. Jako że otyłość i podwyższony poziom lipidów we krwi są traktowane jako czynniki ryzyka chorób przewlekłych, w tym chorób układu krążenia i cukrzycy typu II, można korzystnie oddziaływać na te powiązane ze stylem życia stany chorobowe poprzez regularne spożywanie olejów DAG. [0414] Spożywanie olejów zawierających DAG może odbywać się na szereg sposobów. Zatem, w jednym aspekcie, ujawnienie zapewnia sposób wykorzystywania enzymu według wynalazku do wytwarzania żywności, np. pieczywa, mającego podwyższone poziomy diacyloglicerolu 1,3-DAG i pieczywa zawierającego oleje diacyloglicerolu. W jednym aspekcie, pieczywa oznaczają ciastka, ciasta i podobne pieczywa. [0415] W alternatywnych przykładach wykonania, kombinacja enzymów, którą można stosować w sposobach według ujawnienia, w tym do obróbki olejów jadalnych, obejmują (przy czym jeden, kilka lub wszystkie enzymy w kombinacji zawierają enzym według tego wynalazku): o PLC + PI-PLC + PLA (PLA dodawana po ukończeniu reakcji PLC); o PLD + fosfataza + PI-PLC a następnie PLA; lub, o PLC lub (PLC + PI-PLC) + PLA specyficzna dla kwasu fosfatydowego (wszystkie enzymy dodawane razem lub kolejno). Odśluzowywanie oleju i przetwarzanie oleju roślinnego [0416] Enzymy według ujawnienia (np. polipeptydy według wynalazku mające aktywność lipazy, fosfolipazy, esterazy i/lub glikozydazy lub równorzędną) można stosować na różnych etapach przetwarzania oleju roślinnego takich, jak w ekstrakcji oleju roślinnego, szczególnie, przy usuwaniu ?fosfolipidowych substancji śluzowych? w procesie nazywanym ?odśluzowywaniem oleju?. [0417] Te sposoby według wynalazku można stosować na ?skalę procesu?, np. na skalę od około 15,000; 25,000; 50,000; 75,000; lub 100,000 funtów oleju rafinowanego/dziennie aż do około 1, 2, 3, 4, 5 lub 6 lub więcej milionów funtów oleju rafinowanego/dziennie. [0418] W jednym aspekcie wynalazek zapewnia sposoby odśluzowywania oleju obejmujące stosowanie fosfolipazy według wynalazku. W jednym aspekcie, sposób obejmuje dodatkowo dodawanie kolejnej fosfolipazy (która może również oznaczać fosfolipazę według wynalazku), np. kolejnej PLC, PLA, PLB, PLB lub patatyny według ujawnienia, lub enzymu (który może również oznaczać enzym według ujawnienia) mającego aktywność lizofosfolipazy-transacylazy (LPTA) lub aktywność lizofosfolipazy (LPL) i lizofosfolipazy- -132- transacylazy (LPTA), lub ich kombinację, i/lub fosfolipazy podobnej do patatyny (która może również oznaczać enzym według ujawnienia). W jednym aspekcie, wszystkie enzymy dodaje się razem, lub alternatywnie, enzymy dodaje się w określonej kolejności, np. po dodawaniu PLC następuje dodawanie PLA i/lub dodawanie patatyny; lub, enzym lub enzymy według ujawnienia mające aktywność PC i PE są dodawane jako pierwsze, po czym następuje dodawanie PI PLC w drugiej kolejności. [0419] W jednym aspekcie, sposób ten zapewnia poprawę wydajności, w wyniku traktowania fosfolipazą (np. PLC). W jednym aspekcie, sposób ten zapewnia dodatkowy spadek zawartości fosforu w oleju, w wyniku traktowania fosfolipazą (np. PLA). [0420] W jednym aspekcie, wynalazek zapewnia sposoby obejmujące stosowanie fosfolipazy według wynalazku, do zmniejszania masy substancji śluzowych i podwyższania przyrostu obojętnego oleju (trójglicerydu) przez zmniejszone pułapkowanie oleju. W jednym aspekcie ujawnienie zapewnia sposoby obejmujące stosowanie fosfolipazy według wynalazku, do zwiększania produkcji obojętnych olejów i diacyloglicerolu (DAG), wchodzących w skład fazy olejowej. W alternatywnych aspektach, sposoby według wynalazku (np. procesy odśluzowywania) mogą zawierać jeden lub więcej innych enzymów takich, jak proteaza, amylaza, lipaza, kutynaza, kolejna fosfolipaza (w tym, np. enzym według ujawnienia), karbohydraza, celulaza, pektynaza, mannanaza, arabinaza, galaktanaza, ksylanaza, oksydaza, np. laktaza, i/lub peroksydaza, lub polipeptydy o równorzędnej aktywności, lub ich kombinacje. [0421] Fosfolipazy według wynalazku można stosować na różnych etapach przetwarzania oleju roślinnego takich, jak w ekstrakcji oleju roślinnego, szczególnie, w usuwaniu ?fosfolipidowych substancji śluzowych? w procesie zwanym ?odśluzowywaniem oleju?, jak omówiono powyżej. Wynalazek zapewnia sposoby do przetwarzania olejów roślinnych z różnych źródeł takich, jak otręby ryżowe, nasiona soi, nasiona rzepaku, orzeszki arachidowe i inne orzechy, sezam, słonecznik, palma i kukurydza. Sposoby można stosować w połączeniu z procesami w oparciu o ekstrakcję heksanem, z późniejszym rafinowaniem surowych ekstraktów do postaci olejów jadalnych, z zastosowaniem sposobów i enzymów według wynalazku. Pierwszy etap w sekwencji rafinowania to tzw. proces ?odśluzowywania?, który służy do oddzielenia fosfatydów przez dodawanie wody. Materiał wytrącony przez odśluzowywanie jest oddzielany i poddawany dalszej obróbce do postaci mieszanin lecytyn. Komercyjne lecytyny takie, jak sojowa lecytyna i słonecznikowa lecytyna, są materiałami półstałymi lub bardzo lepkimi. Składają się one z mieszaniny polarnych lipidów, głównie fosfolipidów, i oleju, głównie trójglicerydów. [0422] Fosfolipazy według wynalazku można stosować w dowolnej procedurze ?odśluzowywania?, w tym odśluzowywaniu wodnym, odśluzowywaniu ALCON oleju (np. dla nasion soi), odśluzowywania safinco, ?super odśluzowywaniu?, odśluzowywaniu UF, odśluzowywaniu TOP, uni-odśluzowywaniu, odśluzowywaniu na sucho i odśluzowywaniu ENZYMAX?. Patrz np. Patenty US Nry 6,355,693; US 6,162,623; US 6,103,505; US 6,001,640; US 5,558,781; US 5,264,367. Różne procedury ?odśluzowywania? inkorporowane do sposobów według wynalazku opisano w Bockisch, M. (1998) w Fats and Oils Handbook, -133- The extraction of Vegetable Oils (Chapter 5), 345-445, AOCS Press, Champaign, Illinois. Fosfolipazy według wynalazku można stosować w zastosowaniach przemysłowych enzymatycznego odśluzowywania oleju trójglicerydów, jak opisano, np. w EP 513 709. [0423] W jednym aspekcie, fosfolipazy według wynalazku są stosowane do przetwarzania olejów roślinnych, np. surowych olejów takich, jak otręby ryżowe, soja, rzepak canola, kwiaty i podobne. W jednym aspekcie poprawia to wydajność sposobu odśluzowywania. W jednym aspekcie, ujawnienie zapewnia sposoby do enzymatycznego odśluzowywania w warunkach małej ilości wody, np. w zakresie od około 0,1% do 20% wody, lub 0,5% do 10% wody. W jednym aspekcie powoduje to ulepszony rozdział fazy ciężkiej od fazy olejowej podczas wirowania. Ulepszony rozdział tych faz może skutkować bardziej skutecznym usuwaniem fosfolipidów z oleju, w tym zarówno olejów ulegających uwodnieniu, jak i nieulegających uwodnieniu. W jednym aspekcie, może to dawać frakcję substancji śluzowych, która zawiera mniej porywanego obojętnego oleju (trójglicerydów), tym samym ulepszając ogólną wydajność otrzymywania oleju podczas sposobu odśluzowywania. [0424] W jednym aspekcie fosfolipazy według wynalazku, np. polipeptyd o aktywności PLC, są stosowane do przetwarzania olejów (np. olejów roślinnych, w tym surowych olejów takich, jak otręby ryżowe, soja, rzepak canola, kwiaty i podobne), np. w procesach odśluzowywania, dla zmniejszenia masy substancji śluzowych i podwyższenia przyrostu obojętnego oleju przez zmniejszone pułapkowanie oleju. W jednym aspekcie stosowane są fosfolipazy według wynalazku, np. polipeptyd o aktywności PLC do produkcji diacyloglicerolu (DAG), wchodzącego w skład fazy olejowej. [0425] Fosfolipazy według wynalazku można stosować w zastosowaniach przemysłowych enzymatycznego odśluzowywania jak opisano, np. w CA 1102795, który opisuje sposób izolowania polarnych lipidów z lipidów zboża, przez dodawanie co najmniej 50% wagowych wody. Ten sposób to modyfikowany odśluzowywanie, w takim znaczeniu, że wykorzystuje on zasadę dodawania wody do mieszaniny surowego oleju. [0426] W jednym aspekcie, wynalazek zapewnia enzymatyczne procesy obejmujące stosowanie fosfolipaz według wynalazku (PLC), obejmujące hydrolizę uwodnionych fosfolipidów w oleju w temperaturze około 20°C do 40°C, w zasadowym pH, np. pH około pH 8 do pH 10, przy użyciu czasu reakcji około 3 do 10 minut. Może to dać w wyniku mniej niż 10 ppm końcowego poziomu fosforu w oleju. Wynalazek zapewnia również enzymatyczne procesy obejmujące stosowanie fosfolipaz według wynalazku (PLC), obejmujące hydrolizę ulegających uwodnieniu i nieulegających uwodnieniu fosfolipidów w oleju w temperaturze około 50°C do 60°C, w pH nieznacznie poniżej obojętnego, np. pH około pH 5 do pH 6,5, przy użyciu czasu reakcji około 30 do 60 minut. Może to dać w wyniku mniej niż 10 ppm końcowego poziomu fosforu w oleju. [0427] W jednym aspekcie, wynalazek zapewnia sposoby enzymatyczne, które wykorzystują enzym fosfolipazę C do hydrolizowania wiązania glicerylofosfoestrowego, i tym samym umożliwiają powrót części diacyloglicerydu z fosfolipidów z powrotem do oleju, np. oleju roślinnego, rybnego lub z glonów (?fosfolipaza C (PLC) jako pomoc w kaustycznym -134- rafinowaniu?); oraz obniżają zawartość fosfolipidów w etapie odśluzowywania do poziomów na tyle niskich, żeby możliwe było fizyczne rafinowanie olejów wysokofosforowych (?fosfolipaza C (PLC) jako pomoc w odśluzowywaniu?). Dwa podejścia mogą generować różne wartości i mieć różne zastosowania docelowe. [0428] W różnych przykładowych sposobach według wynalazku, szereg odrębnych etapów składa się na sposób odśluzowywania poprzedzający procesy bielenia rdzenia i rafinowania z odwanianiem. Te etapy obejmują ogrzewanie, mieszanie, przetrzymywanie, oddzielanie i suszenie. Po etapie ogrzewania, dodaje się wodę i często kwas, i miesza się, aby umożliwić aglomerację nierozpuszczalnych fosfolipidowych ?substancji śluzowych? do postaci cząstek, które mogą zostać oddzielone. Podczas gdy woda oddziela wiele z fosfatydów przy odśluzowywaniu, części fosfolipidów stanowią nieulegające uwodnieniu fosfatydy (NHP) obecne jako sole wapnia lub magnezu. Sposoby odśluzowywania oddziałują na te NHP przez dodawanie kwasu. Po uwodnieniu fosfolipidów, olej jest mieszany, przetrzymywany i oddzielany przez wirowanie. Końcowo, olej jest osuszany i przechowywany, wysyłany lub rafinowany, jak zilustrowano, np. na Figurze 6. Powstałe substancje śluzowate są przetwarzane dalej, do otrzymania produktów lecytyny lub dodawane z powrotem do mączki. [0429] W różnych przykładowych sposobach według ujawnienia poziomy fosforu są obniżane na tyle, żeby umożliwić fizyczne rafinowanie. Proces rozdziału może skutkować potencjalnie wyższymi stratami wydajności niż kaustyczne rafinowanie. Dodatkowo, procesy odśluzowywania mogą generować produkty odpadowe, których nie można sprzedawać jako komercyjną lecytynę, patrz np. Figura 7, aby zapoznać się z przykładowym procesem odśluzowywania dla olejów fizycznie olej rafinowanych. W konsekwencji, te procesy nie osiągnęły istotnego udziału w rynku, i procesy rafinowania kaustycznego nadal dominują w przemyśle, w odniesieniu do otrębów ryżowych, soi, rzepaku canola i słonecznika. Należy jednakże zauważyć, że enzym fosfolipaza C stosowany w specjalnym sposobie odśluzowywania będzie obniżać tworzenie się substancji śluzowych i zawracać część diglicerydu z fosfolipidów z powrotem do oleju. [0430] W jednym aspekcie, wynalazek zapewnia sposoby do stosowania PLC według ujawnienia we frakcji substancji śluzowych. W jednym aspekcie tego sposobu, olej dodaje się do surowego oleju, aby utworzyć emulsję, co powoduje przemieszczenie się fosfatydylocholiny, fosfatydyloetanoloaminy i fosfatydyloinozytolu do fazy wodnej (odśluzowywanie wodne). Po wirowaniu te fosfolipidy są głównymi składnikami wodnej frakcji substancji śluzowych. Fosfolipidy we frakcji substancji śluzowych mogą być traktowane fosfolipazą C lub fosfolipazą D plus fosfatazą (lub innymi kombinacjami, odnotowanymi poniżej) w celu wygenerowania diacyloglicerolu (DAG) i estru fosforanowego. W tym momencie można ekstrahować DAG z innych składników substancji śluzowych i traktować lipazą w warunkach odpowiednich do transestryfikacji DAG, do utworzenia pożądanego triacylglicerolu (strukturyzowanego lipidu). [0431] Większość 1,2-DAG może zostać przekształcana do 1,3-DAG przez podwyższanie pH substancji śluzowatej po reakcji PLC, na przykład, przez dodawanie sody kaustycznej. 1,3DAG można następnie ekstrahować z substancji śluzowatej i przereagowywać z lipazą w -135- odpowiednich warunkach, do transestryfikacji 1,3-DAG w pozycji sn2, dla otrzymania pożądanego strukturyzowanego triacyloglicerolu. [0432] Alternatywnie, kwasy tłuszczowe stosowane w reakcji transestryfikacji mogą pochodzić z szeregu źródeł, w tym wolnych kwasów tłuszczowych znajdywanych w surowym oleju. [0433] Fosfolipidy z odśluzowywania wodnego można stosować w kombinacji z PLC według ujawnienia do otrzymania strukturyzowanych lipidów. Olej po odśluzowaniu wodnym może być eksponowany na PLC i/lub PLD (jeden lub oba mogą oznaczać enzymy według wynalazku) plus fosfatazę, lub jedną z tych kombinacji, a następnie PLA (może oznaczać enzym według wynalazku) dla obniżenia zawartości fosforu do poziomów odpowiednich do rafinowania kaustycznego lub fizycznego. [0434] W alternatywnych przykładach wykonania kombinacja enzymów, którą można stosować w sposobach według wynalazku, w tym tych sposobach odśluzowywania, obejmuje (przy czym jeden, kilka lub wszystkie enzymy w kombinacji zawierają enzym według wynalazku): o PLC + PI-PLC + PLA (PLA dodawana po ukończeniu reakcji PLC); o PLD + fosfataza + PI-PLC a następnie PLA; lub, o PLC lub (PLC + PI-PLC) + PLA specyficzna dla kwasu fosfatydowego (wszystkie enzymy dodawane razem lub kolejno). Rafinowanie kaustyczne [0435] Ujawnienie zapewnia sposoby wykorzystujące fosfolipazy (w tym enzymy według ujawnienia) w kaustycznym rafinowaniu, w którym enzymy są stosowane jako pomoc w kaustycznym rafinowaniu. W alternatywnych aspektach, PLC lub PLD i/lub fosfataza są stosowane w sposobach, jako wkroplenia, przed, podczas, lub po procesie rafinowania z kaustycznym zobojętnieniem (rafinowanie ciągłe lub okresowe). Ilość dodawanego enzymu może się różnić, zależnie od procesu. Poziom wody stosowany w proces może być niski, np. około 0,5 do 5%. Alternatywnie, do procesu dodaje się wiele razy sodę kaustyczną. Dodatkowo, sposób można prowadzić w różnych temperaturach (25°C do 70°C), z różnymi kwasami lub substancjami żrącymi, i w zróżnicowanym pH (4-12). Można stosować stężone roztwory sody kaustycznej, np. bardziej stężone niż przemysłowy standard 11 %, do zmniejszenia masy substancji śluzowych. W alternatywnych aspektach, stężony roztwór sody kaustycznej ma stężenie od około 12% do 50%, np. stężenie około 20%, 30%, 40%, 50%, lub 60% lub wyższe. [0436] W jednym aspekcie, enzym fosfolipaza C według wynalazku hydrolizuje fosfatyd z wiązania glicerylofosfoestrowego, w celu wygenerowania diglicerydu i rozpuszczalnego w wodzie związku fosforanu. Hydrolizowany fosfatyd przechodzi do fazy wodnej, pozostawiając digliceryd w fazie olejowej, jak zilustrowano na figurze 8. Jednym z celów PLC ? ?Pomoc w kaustycznym rafinowaniu? jest przekształcanie fosfolipidowych substancji śluzowych, utworzonych podczas zobojętniania w diacylogliceryd, który będzie migrować z -136- powrotem do fazy olejowej. Kontrastowo, jednym z celów ?PLC ? Pomoc w odśluzowywaniu? jest zmniejszenie poziomu fosfolipidów w surowym oleju, do równoważnika fosforu niższego niż 10 części na milion (ppm). [0437] Kwasy, które można stosować w sposobie rafinacji kaustycznej obejmują, w sposób nieograniczający, kwasy fosforowy, cytrynowy, askorbinowy, siarkowy, fumarowy, maleinowy, chlorowodorowy i/lub octowy. Kwasy są stosowane do uwadniania nieulegających uwodnieniu fosfolipidów. Substancje żrące, które można stosować obejmują, w sposób nieograniczający, KOH i NaOH. Substancje żrące są stosowane do zobojętniania wolnych kwasów tłuszczowych. Alternatywnie, fosfolipazy, lub dokładniej PLC lub PLD i fosfataza, są stosowane do oczyszczania fitosteroli z substancji śluzowych/sopstoku. [0438] Alternatywnym przykładem wykonania według ujawnienia do dodawania fosfolipazy przed rafinowaniem kaustycznym jest ekspresja fosfolipazy w roślinie. W innym przykładzie wykonania, fosfolipazę dodaje się w czasie miażdżenia rośliny, nasion lub innej części rośliny. Alternatywnie, fosfolipaza jest dodawana po miażdżeniu, ale przed rafinowaniem (tj. w naczyniach do przetrzymywania). Dodatkowo, fosfolipaza jest dodawana jako obróbka wstępna przed rafinowaniem, z lub bez kwasu. [0439] Kolejnym przykładem wykonania ujawnienia, już opisanym, jest dodawanie fosfolipazy podczas sposobu rafinacji kaustycznej. W tym sposobie poziomy kwasu i substancji żrącej są zróżnicowane, w zależności od poziomu fosforu i poziomu wolnych kwasów tłuszczowych. Dodatkowo, stosuje się szerokie zakresy temperatury i pH w sposobie, w zależności od typu użytego enzymu. [0440] W innym przykładzie wykonania ujawnienia fosfolipaza jest dodawana po kaustycznym rafinowaniu (Fig. 9). W jednym przypadku, fosfolipaza jest dodawana w mieszalniku intensywnym lub w mieszalniku retencyjnym, przed rozdziałem. Alternatywnie, fosfolipaza jest dodawana po etapie ogrzewania. W kolejnym przykładzie wykonania fosfolipaza jest dodawana w etapie wirowania. W dodatkowym przykładzie wykonania fosfolipaza jest dodawana do sopstoku. Alternatywnie, fosfolipaza jest dodawana do wody do przemywania. W kolejnym przypadku, fosfolipaza jest dodawana podczas etapów bielenia i/lub odwaniania. [0441] W jednym aspekcie, fosfolipaza, np. fosfolipaza C, enzym według ujawnienia będzie hydrolizować fosfatyd zarówno z ulegających uwodnieniu, jak i nieulegających uwodnieniu fosfolipidów, w zobojętnianym oleju surowym i olejach odśluzowanych, przed bieleniem i odwanianiem. Przykładowe sposoby ?kaustycznego rafinowania? według ujawnienia są zilustrowane na Figurze 9 i Figurze 13. Figura 9 zawiera przykładowe czasy, temperaturę i pH dla mieszalnika statycznego (30 do 60 min, 50 do 60°C, pH 5 do 6,5) i mieszalnika retencyjnego (3 do 10 min, 20 do 40°C). Docelowy enzym może być aplikowany jako wkraplany produkt w istniejącym sposobie kaustycznego zobojętnienia, jak zilustrowano na Figurze 9. W tym aspekcie nie ma wymogu, by enzym wytrzymywał skrajne poziomy pH, jeśli jest dodawany po dodaniu sody kaustycznej. Jak zilustrowano na Figurze 13 (enzym ?podawany na początku? ? przykładowy sposób), można stosować dowolną fosfolipazę, w -137- tym, np. fosfolipazę według wynalazku taką, jak PLC, PLB, PLA i/lub PLC, w sposobie odśluzowywania surowego oleju, jak opisano, np. w Bailey's Industrial Oil & Fat Products v.4 (red. Y. H. Hui). Figura 14 i Figura 15 ilustrują wariacje sposobów według ujawnienia, w których stosuje się odpowiednio dwa lub trzy etapy wirowania, w sposobie, który można stosować do przetwarzania dowolnego oleju, np. oleju roślinnego takiego, jak surowy olej sojowy, jak pokazano na figurze. Przykładowy sposób z Figury 15 ma etap wirowania przed kaustycznym rafinowaniem (oprócz etapu wirowania po kaustycznym rafinowaniu i przed przemywaniem wodą, oraz po przemywaniu wodą), podczas gdy przykładowy sposób z Figury 14 nie ma etapu wirowania przed kaustycznym rafinowaniem. Figura 16 ilustruje kolejną przykładową wariację tego sposobu, przy użyciu traktowania kwasem i z etapem wirowania przed etapem odśluzowywania; ten przykładowy sposób można stosować do przetwarzania dowolnego oleju, np. oleju roślinnego takiego, jak surowy olej sojowy, jak pokazano na figurze. [0442] W jednym aspekcie, fosfolipaza według wynalazku umożliwia usunięcie fosforu, do niskich poziomów, dopuszczalnych w fizycznym rafinowaniu. W jednym aspekcie, PLC według wynalazku będzie hydrolizować fosfatyd zarówno z ulegających uwodnieniu, jak i nieulegających uwodnieniu fosfolipidów, w surowych olejach, przed bieleniem i odwanianiem. Docelowy enzym może być nanoszony jako wkraplany produkt, w istniejące operacji odśluzowywania, patrz np. Figura 10. Zważywszy na sub-optymalne mieszanie w komercyjnym sprzęcie, jest prawdopodobne, że będzie konieczny kwas, aby doprowadzić do kontaktu nieulegających uwodnieniu fosfolipidów z enzymem na granicy faz olej/woda. W konsekwencji, w jednym aspekcie, stosuje się stabilny w kwasie PLC według wynalazku. [0443] W jednym aspekcie, sposób PLC ? Pomoc w odśluzowywaniu według ujawnienia może wyeliminować straty w jednym, lub wszystkich trzech obszarach wymienionych w tabeli 2. Straty powiązane ze sposobem PLC można oszacować jako wynoszące około 0,8% versus 5,2% w przeliczeniu na masę, ze względu na usuwanie fosfatydu. Tabela 2: Straty Przypisane Produktom PLC 1) Olej utracony przy tworzeniu substancji śluzowych i rozdziale 2.1% 2) Zmydlany olej przy dodawaniu substancji żrących 3.1% 3) Olej uwięziony w glince przy bieleniu* <1.0% Całkowita Utrata Wydajności ?5.2 % Pomoc w Kaustycznym Rafinowaniu Pomoc w Odśluzowywaniu X X X X X ?2.1% ?5.2% [0444] Dodatkowe potencjalne korzyści tego sposobu według ujawnienia w opisie obejmują poniższe: -138- ? Zmniejszona ilość adsorbentów ? wymagane jest mniej adsorbentów przy niższym (< 5 ppm) poziomie fosforu ? Niższe zużycie chemikaliów ? mniej chemikaliów i niższe koszty obróbki powiązane z uwodnieniem nieulegających uwodnieniu fosfolipidów ? Mniej generowania odpadów ? mniej wody wymagane do usunięcia fosforu z oleju [0445] Oleje poddawane obróbce (np. ?odśluzowane?) sposobami według wynalazku obejmują rośliny o nasionach oleistych, np. olej sojowy, olej rzepakowy, olej z otrębów ryżowych i olej słonecznikowy. W jednym aspekcie, ?PLC ? Pomoc w kaustycznym rafinowaniu? według ujawnienia mogą zaoszczędzić 1,2% wobec istniejących sposobów kaustycznego rafinowania. Stosowanie pomocy w rafinowaniu oddziałuje na olej sojowy, który odśluzowano z lecytyny i jest to również odjęte z obliczeń wartości/załadunku. [0446] Cele w zakresie wydajności sposobów według wynalazku w opisie mogą być zróżnicowane, według aplikacji, i bardziej specyficznie co do punktu dodawania enzymu, patrz Tabela 3. Tabela 3: Cele w Zakresie Wydajności według Aplikacji Wejściowe Poziomy Fosforu w Oleju Końcowe Poziomy Fosforu w Oleju Ulegające Uwodnieniu i Nieulegające Uwodnieniu Substancje Śluzowate Pomoc w Kaustycznym Rafinowaniu Pomoc w Odśluzowywaniu <200 ppm* 600-1,400 ppm <10 ppm? <10 ppm Tak Tak Czas Przebywania 3-10 minut 30 minut? Ciekła Formulacja Tak Tak Docelowe pH 8-10??? 5,0-5,5?? Docelowa Temperatura 20-40°C ?50-60°C <5% 1-1.25% Brak lipazy/proteazy1 Brak lipazy/proteazy Usuwanie Fe Usuwanie Fe Zawartość Wody Czystość Formulacji Enzymu Inne Kluczowe Wymagania * Wodne odśluzowywanie oleju ? Docelowe poziomy osiągane powyżej etapu kaustycznego zobojętnienia, ale należy je utrzymywać ? 1-2 godziny istniejące ?? Kwasowe odśluzowywanie będzie wymagać enzymu, który jest stabilny w o wiele bardziej kwasowych warunkach: pH 2,3 dla kwasu cytrynowego w stężeniu 5% (-Roehm USPN 6, 001, 640). -139- ??? pH zobojętnianego oleju nie jest obojętne. Testowanie przy POS wskazuje, że pH będzie z zakresie zasadowym, 6,5-10 (9 grudnia, 2002 r.). Należy wyznaczyć typowy zakres pH. [0447] Inne sposoby, które można stosować z fosfolipazą według wynalazku, np. fosfolipazą A1 mogą przekształcać nieulegające uwodnieniu natywne fosfolipidy do postaci ulegającej uwodnieniu. W jednym aspekcie, enzym jest wrażliwy na wysoką temperaturę. To może być pożądane, jako że ogrzewanie oleju może zniszczyć enzym. Jednakże reakcję odśluzowywania należy dostosować do pH 4-5 i 60°C, aby uwzględnić potrzeby enzymu. Przy 300 jednostkach/kg dawki nasyceniowej oleju, ten przykładowy sposób zachodzi z powodzeniem, obniżając wcześniejszą zawartość fosforu w odśluzowywanym wodnie oleju do poziomu <10 ppm P. Korzyściami mogą być obniżona zawartość H2O i wynikowe oszczędności w stosowaniu, obsłudze i odpadach. Tabela 4 wymienia przykładowe aplikacje do zastosowań przemysłowych dla enzymów według wynalazku: Tabela 4: Przykładowe Aplikacje Pomoc w Kaustycznym Rafinowaniu Olej sojowy z produkcją lecytyny X Chemicznie rafinowany olej sojowy, Olej słonecznikowy, Olej z rzepaku canola X Oleje o niskiej zawartości fosfatydów (np. palmowy) Pomoc w Odśluzowywaniu X X [0448] Oprócz tych różnych sposobów ?odśluzowywania? fosfolipazy według wynalazku można stosować na dowolnym etapie obróbki oleju roślinnego. Na przykład, enzymy fosfolipazy według wynalazku można stosować zamiast PLA, np. fosfolipazy A2, na dowolnym etapie obróbki oleju roślinnego. Oleje które są ?przetwarzane? lub ?odśluzowane? w sposobach według wynalazku obejmują oleje sojowe, oleje rzepakowe, oleje kukurydziane, oleje z ziaren palmowych, oleje z rzepaku canola, oleje słonecznikowe, oleje sezamowe, oleje arachidowe, oleje z otrębów ryżowych i podobne. Do głównych produktów z tego sposobu należą trójglicerydy. [0449] W jednym z przykładowych sposobów, gdy enzym jest dodawany do i przereagowywany z surowym olejem, ilość użytej fosfolipazy wynosi około 10-10,000 jednostek, lub, alternatywnie, około 100-2,000 jednostek, na 1 kg surowego oleju. Obróbka enzymem jest prowadzona przez 5 min do 10 godzin, w temperaturze 30°C do 90°C, lub alternatywnie, około, 40°C do 70°C. Warunki mogą się różnić, w zależności od optymalnej temperatury enzymu. Ilość wody, dodawanej dla rozpuszczenia enzymu wynosi 5-1,000 części wag. na 100 części wag. surowego oleju, lub, alternatywnie, około 10 do 200 części wag. na 100 części wag. surowego oleju. [0450] Po zakończeniu takiej obróbki enzymem, ciekły enzym jest oddzielany, odpowiednimi sposobami takimi, jak separator odśrodkowy i otrzymuje się przetworzony olej. Zawierające fosfor związki, wyprodukowane w związku z rozłożeniem przez enzym substancji -140- żywicznych w takim sposobie są praktycznie wszystkie przeniesione do fazy wodnej i usunięte z fazy olejowej. Po zakończeniu obróbki enzymem, o ile jest to konieczne, przetworzony olej może być dodatkowo przemywany wodą, lub kwasem organicznym lub nieorganicznym, takim jak, np. kwas octowy, kwas cytrynowy, kwas fosforowy, kwas bursztynowy, i równorzędnymi kwasami, lub roztworami soli. [0451] W jednym z przykładowych sposobów do ultra-filtracyjnego odśluzowywania, enzym jest związany z filtrem lub enzym jest dodawany do oleju przed filtracją, lub enzym jest stosowany do okresowego czyszczenia filtrów. [0452] W jednym z przykładowych sposobów do wspomagania regulowanego fosfolipazą fizycznego rafinowania, wodę i enzym dodaje się do surowego oleju (np. surowego oleju roślinnego). W jednym aspekcie, stosuje się PLC lub PLD według wynalazku i fosfatazę w sposobie. W regulowanym fosfolipazą fizycznym rafinowaniu, poziom wody może być niski, tj. 0,5 - 5% i czas trwania sposobu powinien być krótki (mniej niż 2 godziny, lub mniej niż 60 minut, lub mniej niż 30 minut, mniej niż 15 minut, lub mniej niż 5 minut). Sposób można prowadzić w różnych temperaturach (25°C do 70°C), z różnymi kwasami i/lub substancjami żrącymi, i w zróżnicowanym pH (np. 3-10). [0453] W alternatywnych aspektach, odśluzowywanie wodne jest wykonywane jako pierwsze, aby zebrać lecytynę przez wirowanie, a następnie dodaje się PLC lub PLC i PLA według wynalazku, do usunięcia nieulegających uwodnieniu fosfolipidów (sposób należy prowadzić z małą ilością wody). W innym aspekcie, wykonuje się odśluzowywanie wodne surowego oleju do mniej niż 10 ppm (oleje jadalne) i późniejsze fizyczne rafinowanie (mniej niż 50 ppm dla biodiesla). W jednym aspekcie, dodaje się emulgator i/lub poddawać surowy olej działaniu mieszalnika intensywnego, w celu stymulowania mieszania. Alternatywnie, dodaje się demulgator i/lub ogrzewa się surowy olej, aby stymulować rozdział fazy wodnej. W innym aspekcie, dodaje się kwas w celu stymulowania uwodnienia nieulegających uwodnieniu fosfolipidów. Dodatkowo, można stosować fosfolipazy do regulacji oczyszczania fitosteroli z substancji śluzowych/sopstoku. [0454] W jednym aspekcie wynalazek zapewnia kompozycje i sposoby (który mogą obejmować stosowanie fosfolipaz według wynalazku) do odśluzowywania oleju, obejmującego stosowanie zróżnicowanych ilości kwasu i zasady, bez otrzymywania sopstoku. Stosując ten aspekt wynalazku do odśluzowywania oleju można stosować kwas (w tym fosforowy i/lub cytrynowy) do uwodnienia nieulegających uwodnieniu fosfolipidów w olejach wysokofosforowych (w tym soja, rzepak canola i słonecznik). Po uwodnieniu fosfolipidów można podwyższyć pH fazy wodnej przy użyciu kaustycznego dodawania: ilość dodanej sody kaustycznej może utworzyć pH korzystne dla aktywności enzymu, ale nie będzie skutkować utworzeniem istotnej frakcji sopstoku w oleju. Ponieważ nie tworzy się sopstok, wolne kwasy tłuszczowe w oleju można usuwać dalej po etapie odśluzowywania, podczas bielenia i odwaniania. [0455] Enzymy według wynalazku są stosowane do poprawienia ekstrakcji oleju i odśluzowywania oleju (np. olejów roślinnych). W jednym aspekcie, w sposobie według -141- wynalazku stosuje się PLC według wynalazku i co najmniej jedną substancję degradującą ścianę komórki roślinnej (np. celulaza, hemicelulaza lub podobne, dla zmiękczenia ścian i podwyższenia wydajności ekstrakcji). W tym przykładowym podejściu do stosowania enzymów według wynalazku do poprawienia ekstrakcji oleju i odśluzowywania oleju, stosuje się fosfolipazę C według wynalazku, jak również inne hydrolazy (np. celulazę, hemicelulazę, esterazę, proteazę i/lub fosfatazę) podczas etapów miażdżenia powiązanych z produkcją oleju (w tym bez ograniczania do wymienionych soja, rzepak canola, słonecznik, olej z otrębów ryżowych). Dzięki użyciu enzymów przed lub zamiast ekstrakcji z zastosowaniem rozpuszczalnika możliwe jest podwyższenie wydajności oleju i zmniejszenie ilości ulegających uwodnieniu i nieulegających uwodnieniu fosfolipidów w surowym oleju. Obniżenie ilości nieulegających uwodnieniu fosfolipidów może być skutkiem konwersji potencjalnie nieulegających uwodnieniu fosfolipidów do diacyloglicerolu i odpowiadającego estru fosforanu przed kompleksowaniem wapniem lub magnezem. Ogólne obniżenie poziomu fosfolipidów w surowym oleju będzie prowadzić do ulepszonej wydajności podczas rafinowania, z potencjalnym eliminowaniem wymogu stosowania odrębnego etapu odśluzowywania przed bieleniem i odwanianiem. [0456] W jednym aspekcie, ujawnienie zapewnia sposoby do stosowania fosfolipazy według wynalazku (np. specyficznej dla fosfolipazy fosfohydrolazy według wynalazku), lub kolejnej fosfolipazy, w modyfikowanym ?sposobie organicznego rafinowania?, który może obejmować dodawanie enzymu (np. PLC) w zbiorniku do przetrzymywania kwasu cytrynowego. [0457] Enzymy według wynalazku można stosować w dowolnym sposobie obróbki oleju, np. sposobach odśluzowywania lub równorzędnych. Na przykład, enzymy według wynalazku można stosować w sposobach jak opisano w Patentach US Nry 5,558,781; US 5,264,367; US 6,001,640. Sposób opisany w USPN 5,558,781 wykorzystuje fosfolipazę A1, A2 lub B, zasadniczo rozkładając lecytynę w oleju, który zachowuje się jak emulgator. [0458] Enzymy i sposoby według wynalazku można stosować w sposobach do obniżania ilości składników zawierających fosfor w olejach jadalnych, zawierających dużą ilość nieulegającego uwodnieniu fosforu, poprzez stosowanie fosfolipazy według wynalazku, np. polipeptydu mającego aktywność fosfolipazy A i/lub B, jak opisano, np. w patencie EP nr: EP 0869167. W jednym aspekcie, jadalny olej oznacza surowy olej, tzw. ?nieodśluzowany olej?. W jednym aspekcie, sposób obejmuje traktowanie nieodśluzowanego oleju, w tym olejów tłoczonych lub ekstrahowanych, lub ich mieszaniny, z np. nasion rzepaku, soi, sezamu, orzechów ziemnych, kukurydzy, otrębów ryżowych lub słonecznika. Zawartość fosfatydów w surowym oleju może się wahać od 0,5 do 3% wag./wag. odpowiadających zawartości fosforu w zakresie 200 do 1200 ppm, lub w zakresie 250 do 1200 ppm. Poza fosfatydami surowy olej może również zawierać niewielkie stężenia węglowodanów, związków cukru i kompleksów kwasów metali/fosfatydów Ca, Mg i Fe. W jednym aspekcie sposób obejmuje traktowanie fosfolipidu lub lizofosfolipidu fosfolipazą według wynalazku, aby hydrolizować grupy tłuszczowo-acylowe. W jednym aspekcie fosfolipid lub lizofosfolipid zawiera lecytynę lub lizolecytynę. W jednym aspekcie, w sposobie olej jadalny ma zawartość fosforu od około 50 -142- do 250 ppm, i sposób obejmuje traktowanie oleju fosfolipazą według wynalazku, aby zhydrolizować większą część fosfolipidów i oddzielić fazę wodną zawierającą hydrolizowany fosfolipid od oleju. W jednym aspekcie, przed sposobem enzymatycznego odśluzowywania olej odśluzowuje się wodą. W jednym aspekcie, sposoby zapewniają produkcję paszy dla zwierząt, obejmując mieszanie fosfolipazy według wynalazku z substancjami paszy i co najmniej jednym fosfolipidem. [0459] Enzymy i sposoby według wynalazku można stosować w sposobach odśluzowywania oleju jak opisano, np. w WO 98/18912. Fosfolipazy według wynalazku można stosować do zmniejszania zawartości fosfolipidu w jadalnym oleju. Sposób może obejmować traktowanie oleju fosfolipazą według wynalazku, w celu zhydrolizowania większej części fosfolipidu i oddzielania fazy wodnej, zawierającej hydrolizowany fosfolipid od oleju. Ten sposób ma zastosowanie do oczyszczania dowolnego jadalnego oleju, który zawiera fosfolipid, np. olejów roślinnych takich, jak olej sojowy, olej z otrębów ryżowych, olej rzepakowy i olej słonecznikowy, olejów rybnych, z glonów, olejów zwierzęcych i podobnych. Przed traktowaniem enzymatycznym, olej roślinny jest korzystnie poddawany wstępnej obróbce, do usunięcia szlamu (śluzu), np. przez rafinowanie na mokro. Olej może zawierać od około 50 do 250 ppm, lub od 50 do około 1500 ppm, lub więcej, fosforu, jako fosfolipidu na początku traktowania fosfolipazą, i sposób według wynalazku może zmniejszyć tę wartość do poziomu poniżej od około 5 do 10 ppm. [0460] Enzymy według wynalazku można stosować w sposobach jak opisano w Zgłoszeniu JP Nr: H5-132283, zgłoszonym 25 kwietnia 1993 r., które zawiera sposób oczyszczania olejów i tłuszczy, zawierający etap przekształcania fosfolipidów obecnych w olejach i tłuszczach do rozpuszczalnych w wodzie substancji zawierających grupy kwasu fosforowego i usuwanie ich, jako rozpuszczalnych w wodzie substancji. Działanie enzymu stosuje się do konwersji do postaci rozpuszczalnych w wodzie substancji. Enzym mający aktywność fosfolipazy C jest korzystnie stosowany jako enzym. [0461] Enzymy według wynalazku można stosować w sposobach jak opisano w ?sposobie organicznego rafinowania? (ORP) (IPH, Omaha, NE), który oznacza sposób rafinowania olejów z nasion. ORP może wykazywać cechy przewyższające tradycyjne rafinowanie chemiczne, w tym ulepszona wydajność oleju rafinowanego, produkty uboczne stanowiące wartość dodaną, obniżone koszty kapitałowe i niższe koszty środowiskowe. [0462] Enzymy według wynalazku można stosować w sposobach do traktowania oleju lub tłuszczu, zwierzęcego lub roślinnego, surowego, półprzetworzonego lub rafinowanego, obejmujących dodawanie do takiego oleju lub tłuszczu co najmniej jednego enzymu według wynalazku, co umożliwia hydrolizowanie i/lub depolimeryzowanie nieglicerydowych związków zawartych w oleju, jak opisano, np. w Zgłoszeniu EP: 82870032.8. Przykładowe sposoby według ujawnienia do hydrolizy i/lub depolimeryzacji nieglicerydowych związków w olejach to: 1) Dodawanie i mieszanie w olejach i tłuszczach enzymu według wynalazku lub kompleksów enzymu rozpuszczonych wcześniej w małej ilości odpowiedniego -143- rozpuszczalnika (na przykład wody). Dopuszcza się pewną liczbę rozpuszczalników, ale wybiera się rozpuszczalnik nietoksyczny i odpowiedni dla enzymu. To dodawanie można prowadzić w sposobach z sukcesywnym załadunkiem, jak również w sposobach ciągłych. Ilość enzymu, którego dodanie do olejów i tłuszczy jest konieczne, według tego sposobu, może się wahać, w zależności od enzymów i produktów do przetworzenia, od około 5 do 4 00 ppm, lub od około 20 do 400 ppm; np. 0,005 kg do 0,4 kg enzymu na 1000 kg oleju lub tłuszczu, i korzystnie od 5 do 100 ppm, tj. od 0,005 do 0,1 kg enzymu na 1000 kg oleju, te wartości przyjmuje się dla stężonych enzymów, tj. bez rozcieńczalnika lub rozpuszczalnika. 2) Przepuszczanie oleju lub tłuszczu przez unieruchomione lub nierozpuszczalne złoże do filtrowania enzymu(-ów) według wynalazku, na nośniku stałym lub półstałym, korzystnie stanowiącym strukturę porowatą lub włóknistą. W tej technice enzymy są uwięzione w mikrozagłębieniach porowatej lub włóknistej struktury nośników. Te składają się, na przykład, z żywic lub syntetycznych polimerów, węglanów celulozy, żeli takich jak agaroza, filamentów polimerów lub kopolimerów o porowatej strukturze, wychwytujących niewielkie kropelki enzymu w roztworze, w swoich zagłębieniach. Odnośnie stężenia enzymu, możliwe jest podwyższanie, aż do wysycenia nośników. 3) Dyspersja olejów i tłuszczy w postaci drobnych kropelek, w rozcieńczonym roztworze enzymatycznym, zawierającym w alternatywnych aspektach od około 0,05 do 4%, lub zawierającym od około 0,2 do 4% objętościowo enzymu według wynalazku. Tę technikę opisano, np. w patencie belgijskim Nr 595,219. Cylindryczną kolumnę, o wysokości kilku metrów, z pokrywą stożkową, wypełnia się rozcieńczonym roztworem enzymatycznym. W tym celu wybiera się rozpuszczalnik, który jest nietoksyczny i nie miesza się z olejem lub tłuszczem do przetworzenia, korzystnie wodę. Spód kolumny jest wyposażony w system dystrybucji, w którym ciągle wstrzykuje się olej lub tłuszcz w skrajnie rozdrobnionej postaci (przepływ w przybliżeniu 10,000 na m2). Zatem tworzy się nieskończona liczba kropelek oleju lub tłuszczu, która powoli wznosi się w roztworze enzymów i spotyka się na powierzchni, do usuwania w sposób ciągły od strony szczytu stożkowej pokrywy reaktora. [0463] Olej palmowy może być poddawany wstępnej obróbce przed traktowaniem enzymem według wynalazku. Na przykład, około 30 kg surowego oleju palmowego jest ogrzewane do +50°C. 1% roztworów otrzymywano w destylowanej wodzie, z celulazami i pektynazami. 600 g każdego z nich dodawano do wodnych roztworów oleju, z silnym mieszaniem, przez kilka minut. Olej jest następnie trzymany w +50°C, z umiarkowanym mieszaniem, przez czas reakcji ogółem dwie godziny. Następnie, temperaturę podwyższa się do +90°C, aby inaktywować enzymy i przygotować mieszaninę do filtracji i dalszej obróbki. Olej jest suszony pod próżnią i filtrowany przy użyciu wspomagania filtrowania. [0464] Enzymy według wynalazku można stosować w sposobach jak opisano w europejskim zgłoszeniu patentowym EP 0 513 709 B2. Na przykład, ujawnienie zapewnia sposób do zmniejszania sposób do zmniejszania zawartości składników zawierających fosfor w olejach -144- zwierzęcych i roślinnych, przez rozkład enzymatyczny, przy użyciu fosfolipazy według wynalazku. W alternatywnych aspektach, oleje zwierzęce i roślinne, poddawane wstępnemu usuwaniu śluzów, o zawartości fosforu od około 50 do 1500 ppm, lub od około 50 do 250 ppm, miesza się z organicznym kwasem karboksylowym, a wartość pH powstałej mieszaniny nastawia się na od około pH 4 do pH 6, roztwór enzymu, który zawiera fosfolipazę A1, A2, lub B według ujawnienia jest dodawany do mieszaniny w naczyniu do mieszania, w warunkach turbulentnego mieszania i z utworzeniem drobnych kropelek, przy czym tworzy się emulsja z 0,5 do 5 % wagowych względem oleju, wymieniona emulsja jest przeprowadzana przez co najmniej jedno późniejsze naczynie do reakcji, w warunkach turbulentnego mieszania, gdy czas reakcji wynosi 0,1 do 10 godzin, w temperaturach w zakresie od 20 do 80°C i gdzie przetwarzany olej, po rozdziale wodnego roztworu, ma zawartość fosforu poniżej 5 ppm. [0465] Sposób organicznego rafinowania ma zastosowanie zarówno wobec surowego, jak i odśluzowanego oleju. Sposób wykorzystuje wbudowane dodawanie kwasu organicznego, w kontrolowanych warunkach sposobu, w połączeniu z konwencjonalnym rozdziałem przez wirowanie. Woda, naturalnie oddzielona od fosfolipidów oleju roślinnego (?VOP?) jest zawracana do obiegu i wykorzystywana ponownie. Całkowite zużycie wody może być zasadniczo obniżone, w wyniku sposobu rafinowania organicznego. [0466] Fosfolipazy i sposoby według wynalazku można również stosować w enzymatycznym traktowaniu olejów jadalnych, jak opisano, np. w Patencie US Nr 6,162,623. W tych przykładowych sposobach, ujawnienie zapewnia amfifilowy enzym. Może on być unieruchamiany, np. przez otrzymywanie emulsji zawierającej ciągłą fazę hydrofobową i dyspergowaną fazę wodną, zawierającą enzym i nośnik dla enzymu, i usuwanie wody z fazy dyspergowanej, dopóki ta faza nie przekształci się w stałe cząstki pokryte enzymem. Enzym może oznaczać lipazę. Unieruchamianą lipazę można stosować do reakcji katalizowanych przez lipazę takich, jak interestryfikacja mono-, di- lub trójglicerydów, odkwaszanie trójglicerydowego oleju, lub usuwanie fosfolipidów z trójglicerydowego oleju, gdy lipaza oznacza fosfolipazę. Faza wodna może zawierać ciecz fermentacyjną, jadalny trójglicerydowy olej może oznaczać fazę hydrofobową, a nośniki obejmują cukry, skrobię, dekstran, rozpuszczalne w wodzie pochodne celulozy i pozostałości fermentacji. Ten przykładowy sposób można stosować do przetwarzania trójglicerydów, diglicerydów, monoglicerydów, glicerolu, fosfolipidów, glikolipidów lub kwasów tłuszczowych, które mogą znajdować się w fazie hydrofobowej. W jednym aspekcie, sposób usuwania fosfolipidów z trójglicerydowego oleju zawierający mieszanie trójglicerydowego oleju zawierającego fosfolipidy z preparatem zawierającym fosfolipazę według wynalazku; hydrolizowanie fosfolipidów do lizofosfolipidu; oddzielanie hydrolizowanych fosfolipidów od oleju, przy czym fosfolipaza oznacza unieruchamianą fosfolipazę. [0467] Fosfolipazy i sposoby według wynalazku można również stosować w enzymatycznym traktowaniu olejów jadalnych, jak opisano, np. w Patencie US Nr 6,127,137. W tym przykładowym sposobie hydrolizuje się zarówno grupy tłuszczowe, jak i acylowe, w nienaruszonym fosfolipidzie. Fosfolipaza według wynalazku stosowana w tym -145- przykładowym sposobie nie ma aktywności lipazy i jest aktywna w bardzo niskim pH. Te właściwości czynią ją bardzo odpowiednią do stosowania w odśluzowywaniu oleju, jako że można hamować zarówno enzymatyczną, jak i alkaliczną hydrolizę (zmydlanie) oleju. W jednym aspekcie, wynalazek zapewnia sposób hydrolizowania grup acylo-tłuszczowych w fosfolipidzie lub lizofosfolipidzie, obejmujący traktowanie fosfolipidu lub lizofosfolipidu fosfolipazą, która hydrolizuje zarówno grupy acylo-tłuszczowe w fosfolipidzie i jest zasadniczo wolna od aktywności lipazy. W jednym aspekcie, fosfolipaza według wynalazku ma optimum temperatury przy około 50°C, mierzone w pH 3 do pH 4 przez 10 minut, i optimum pH przy około pH 3, mierzone w 40°C przez około 10 minut. W jednym aspekcie, fosfolipid lub lizofosfolipid zawiera lecytynę lub lizolecytynę. W jednym aspekcie, po hydrolizowaniu większej części fosfolipidu oddziela się fazę wodną, zawierającą hydrolizowany fosfolipid od oleju. W jednym aspekcie, ujawnienie zapewnia również sposób do usuwania fosfolipidu z jadalnego oleju, zawierający traktowanie oleju w pH 1,5 do 3, z dyspersją wodnego roztworu fosfolipaza według wynalazku, i oddzielanie fazy wodnej zawierającej hydrolizowany fosfolipid od oleju. W jednym aspekcie, olej jest poddawany obróbce w celu usunięcia śluzu przed traktowaniem fosfolipazą. W jednym aspekcie, olej przed traktowaniem fosfolipazą zawiera fosfolipid w ilości odpowiadającej 50 do 250 ppm fosforu. W jednym aspekcie, traktowanie fosfolipazą prowadzi się w 30°C do 45°C przez 1 do 12 godzin, z dozowaniem fosfolipazy rzędu 0,1 do 10 mg/l, w obecności 0,5 do 5% wody. [0468] Fosfolipazy i sposoby według wynalazku można również stosować w enzymatycznym traktowaniu olejów jadalnych, jak opisano, np. w Patencie US Nr 6,025,171, W tym przykładowym sposobie, enzymy według wynalazku są unieruchamiane przez przygotowywanie emulsji, zawierającej ciągłą fazę hydrofobową taką, jak olej trójglicerydowy, i dyspergowaną fazę wodną, zawierającą amfifilowy enzym taki, jak lipaza lub fosfolipaza według wynalazku, i materiał nośnika, który jest częściowo rozpuszczony i częściowo nierozpuszczony w fazie wodnej, i usuwanie wody z fazy wodnej, do momentu, aż faza nie przekształci się w stałe cząstki pokryte enzymem. Nierozpuszczoną część materiału nośnika może stanowić materiał, który jest nierozpuszczalny w wodzie i oleju, lub rozpuszczalny w wodzie materiał w nierozpuszczonej postaci, ponieważ faza wodna jest już nasycona rozpuszczalnym w wodzie materiałem. Faza wodna może tworzyć się z surowej cieczy fermentacyjnej lipazy, zawierającej pozostałości fermentacji, i biomasy, która może służyć jako materiały nośnikowe. Unieruchamiana lipaza jest użyteczna do rearanżacji estrów i odkwaszania w olejach. Po reakcji unieruchamiany enzym może być regenerowany do późniejszej reakcji, przez dodawanie wody, do otrzymania częściowego rozpuszczenia nośnika, i z wynikowym enzymem i zawierającą nośnik fazą wodną dyspergowaną w hydrofobowej fazie, z odparowywaniem wody, do ponownego utworzenia pokrytych enzymem cząstek nośnika. [0469] Fosfolipazy i sposoby według wynalazku można również stosować w enzymatycznym traktowaniu olejów jadalnych, jak opisano, np. w Patencie US Nr 6,143,545. Ten przykładowy sposób jest stosowany do obniżania zawartości zawierających fosfor składników w jadalnym oleju, zawierającym duże ilości zawartości ? nieulegającego uwodnieniu fosforu, przy użyciu fosfolipazy według wynalazku. W jednym aspekcie, sposób jest stosowany do -146- zmniejszenia zawartości składników zawierających fosfor w jadalnym oleju, mającym zawartość nieulegającego uwodnieniu fosforu rzędu co najmniej 50 ppm, co mierzono przy wstępnym przetwarzaniu jadalnego oleju, w 60°C, przez dodawanie roztworu zawierającego kwas cytrynowy jednowodny w wodzie (dodawana woda vs. olej wynosi 4,8% wag./wag.; (kwas cytrynowy) w fazie wodnej = 106 mM, w emulsji woda/olej = 4,6 mM) przez 30 minut; przenoszenie 10 ml wstępnie traktowanej emulsji typu woda w oleju do probówki; ogrzewanie emulsji w łaźni z wrzącą wodą przez 30 minut; wirowanie przy 5000 rpm przez 10 minut, przenoszenie około 8 ml górnej fazy (olejowej) do nowej probówki i pozostawienie jej do osadzenia na 24 godziny; i pobieranie 2 g z górnej, klarownej fazy do pomiaru zawartości nieulegającego uwodnieniu fosforu (ppm) w oleju jadalnym. Sposób może również zawierać kontaktowanie oleju w pH od około pH 5 do 8 z wodnym roztworem fosfolipazy A lub B według wynalazku (np. PLA1, PLA2, lub PLB), który to roztwór jest emulgowany w oleju do momentu, aż zawartość fosforu w oleju obniży się poniżej niż 11 ppm, i następnie oddzielanie fazy wodnej z traktowanego oleju. [0470] Fosfolipazy i sposoby według wynalazku można również stosować w enzymatycznym traktowaniu olejów jadalnych, jak opisano np. w Patencie US Nr 5,532,163. Wynalazek zapewnia sposoby do rafinowania oleju i tłuszczu, za pomocą których fosfolipidy w oleju i tłuszcz do przetwarzania można skutecznie rozkładać i usuwać. W jednym aspekcie wynalazek zapewnia sposoby do rafinowania oleju i tłuszczu, który zawiera przereagowywanie, w emulsji, oleju i tłuszczu z enzymem według wynalazku, np. enzymem mającym aktywność rozkładania wiązań estrowych glicerol-kwas tłuszczowy w glicerofosfolipidach (np. PLA2 według ujawnienia); i kolejny sposób, w którym traktowane enzymem olej i tłuszcz są przemywane wodą lub kwasowym roztworem wodnym. W jednym aspekcie, kwasowy wodny roztwór do stosowana w etapie przemywania oznacza roztwór co najmniej jednego kwasu, np. kwasu cytrynowego, kwasu octowego, kwasu fosforowego i ich soli. W jednym aspekcie, stan emulgacji jest tworzony przy użyciu 30 części wagowych lub więcej wody na 100 części wagowych oleju i tłuszczu. Jako że olej i tłuszcz mogą być oczyszczone bez zastosowania konwencjonalnego etapu zasadowego rafinowania, można zmniejszyć generowanie odpadowej wody do przemywania i odpadów przemysłowych. Dodatkowo, wydajność odzyskiwania oleju jest ulepszona, ponieważ w innowacyjnym sposobie nie dochodzi do utraty obojętnego oleju i tłuszczu ze względu na ich włączenie do tych odpadów. W jednym aspekcie, ujawnienie zapewnia sposoby do rafinowania oleju i tłuszczu zawierających około 100 do 10,000 ppm fosfolipidów, który to sposób obejmuje: przereagowywanie, w stanie zemulgowanym, wymienionego oleju i tłuszczu z enzymem według wynalazku mającym aktywność rozkładania wiązań estrowych glicerol-kwas tłuszczowy w glicerofosfolipidach. W jednym aspekcie, ujawnienie zapewnia sposoby do rafinowania oleju i tłuszczu zawierających około 100 do 10,000 ppm fosfolipidów, który obejmuje przereagowywanie, w stanie zemulgowanym, oleju i tłuszczu z enzymem według wynalazku mającym aktywność rozkładania wiązań estrowych glicerol-kwas tłuszczowy w glicerofosfolipidach; i później odmywanie traktowanego oleju i tłuszczu wodą do przemywania. -147- [0471] Fosfolipazy i sposoby według wynalazku można również stosować w enzymatycznym traktowaniu olejów jadalnych, jak opisano, np. w Patencie US Nr 5,264,367. Zawartość składników zawierających fosfor i zawartość żelaza w jadalnym oleju roślinnym lub zwierzęcym, takim jak olej, np. olej sojowy, który poddawano rafinowaniu na mokro, do usunięcia śluzu, są obniżone przez enzymatyczny rozkład, poprzez kontaktowanie oleju z wodnym roztworem enzymu według wynalazku, np. fosfolipazy A1, A2, lub B, i następnie oddzielanie fazy wodnej z traktowanego oleju. W jednym aspekcie, wynalazek zapewnia enzymatyczny sposób obniżania zawartości składników zawierających fosfor- i żelazo w olejach, które rafinowano dla usunięcia śluzu. Olej, który rafinowano do usunięcia śluza, może być traktowany enzymem według wynalazku, np. fosfolipazą C. Można osiągnąć zawartość fosforu poniżej 5 ppm i zawartość żelaza poniżej 1 ppm. Niska zawartość żelaza może być korzystna dla stabilności oleju. [0472] Fosfolipazy i sposoby według wynalazku można również stosować do otrzymywania olejów transestryfikowanych, jak opisano, np. w Patencie US Nr 5,288,619. Wynalazek zapewnia sposoby do enzymatycznej transestryfikacji, do otrzymywania oleju margaryny, mających niską zawartość zarówno kwasów trans, jak i łańcuchów kwasów tłuszczowych o średniej długości. Sposób obejmuje etapy zapewniania reakcji transestryfikacji mieszaniny zawierającej materiał źródłowy kwasu stearynowego i jadalny ciekły olej roślinny, transestryfikowanie materiału źródłowego kwasu stearynowego i oleju roślinnego przy użyciu 1-, 3-pozycyjnie specyficznej lipazy, i następnie na końcu uwodornianie mieszaniny kwasów tłuszczowych, dla zapewnienia zawracanego do obiegu materiału źródłowego kwasu stearynowego, do powtarzanej cyklicznie reakcji z olejem roślinnym. Ujawnienie zapewnia również przeciwprądowy sposób otrzymywania trans estryfikowanego oleju. Sposób obejmuje etapy zapewniania strefy reakcji transestryfikacji zawierającej 1-, 3- pozycyjnie specyficzną lipazę, wprowadzania oleju roślinnego do strefy transestryfikacji, wprowadzania materiału źródłowego kwasu stearynowego, przeprowadzania nadkrytycznego gazu lub podkrytycznego skroplonego gazu w ciekłym przeciwprądzie, wykonywania reakcji transestryfikacji strumienia trójglicerydu kwasem stearynowym lub strumieniem monoestru kwasu stearynowego w strefie reakcji, wycofywania strumienia transestryfikowanego trójglicerydu oleju margaryny, wycofywania przeciwprądowej fazy ciekłej, uwodorniania transestryfikowanego kwasu stearynowego lub monoestru kwasu stearynowego, dla zapewnienia uwodornionego zawracanego do obiegu materiału źródłowego kwasu stearynowego, i wprowadzania uwodornionego zawracanego do obiegu materiału źródłowego kwasu stearynowego do strefy reakcji. [0473] W jednym aspekcie, wysoce nienasycony związek fosfolipidowy może być przekształcany do trójglicerydu przez odpowiednie stosowanie fosfolipazy C według ujawnienia, do usunięcia grupy fosforanowej w pozycji sn-3, a następnie syntezy 1,3-lipaz estru acylowego. 2-Podstawiony fosfolipid można stosować jako funkcjonalny składnik żywności bezpośrednio, lub może być on później selektywnie hydrolizowany w reaktorze 160, przy użyciu unieruchamianej fosfolipazy C według wynalazku, do produkcji 1diglicerydu, a następnie opisanej tu enzymatycznej estryfikacji, do produkcji produktu trójglicerydu mającego składnik 2-podstawiony wielonienasycony kwas tłuszczowy. -148- [0474] Fosfolipazy i sposoby według wynalazku można również stosować w enzymatycznym sposobie odśluzowywania olejów jadalnych, jak opisano np. w Patencie US Nr 6,001,640. Ten sposób według wynalazku zawiera etap odśluzowywania w produkcji olejów jadalnych. Oleje roślinne, z których usunięto ulegające uwodnieniu fosfatydy we wcześniejszym sposobie wodnego odśluzowywania są wolne od nieulegających uwodnieniu fosfatydów, przez enzymatyczne traktowanie przy użyciu fosfolipazy według wynalazku. Sposób może być łagodny, ekonomiczny i przyjazny dla środowiska. Fosfolipazy, które hydrolizują wyłącznie lizolecytynę, ale nie lecytynę, są stosowane w tym sposobie odśluzowywania. [0475] W jednym aspekcie, aby umożliwić działanie enzymowi według wynalazku, obie fazy, faza olejowa i faza wodna, które zawierają enzym, muszą być dokładnie zmieszane. Zwykłe mieszanie ich może okazać się niewystarczające. Łatwiej osiągnąć dobrą dyspersję enzymu w oleju, jeśli jest on rozpuszczony w niewielkiej ilości wody, np. 0,5-5% wag. (względem oleju), i emulgowany w oleju w tej postaci, do utworzenia kropelek mających mniej niż 10 mikrometrów w średnicy (wagowo średnia). Kropelki mogą być mniejsze niż 1 mikrometr. Turbulentne mieszanie można prowadzić z prędkościami radialnymi powyżej 100 cm/s. Olej może również podlegać krążeniu w reaktorze, przy użyciu zewnętrznej pompy rotacyjnej. Fazę wodną zawierającą enzym można również dokładnie zdyspergować za pomocą działania ultradźwięków. Można stosować urządzenie dyspergujące. [0476] Reakcja enzymatyczna zachodzi prawdopodobnie na powierzchni granicznej pomiędzy fazą olejową i fazą wodną. Celem wszystkich tych środków do mieszania jest wytworzenie możliwie największej powierzchni dla fazy wodnej, która zawiera enzym. Dodawanie środków powierzchniowo czynnych zwiększa mikrodyspersję fazy wodnej. W niektórych przypadkach, w konsekwencji, środki powierzchniowo czynne o wartościach HLB powyżej 9 takie, jak Na-dodecylosiarczan, dodaje się do roztworu enzymu, jak opisano, np. w EP-A 0 513 709. Podobnym, skutecznym sposobem ulepszania emulsyfikacji jest dodawanie lizolecytyny. Dodawane ilości mogą mieścić się w zakresie 0,001% do 1%, w odniesieniu do oleju. Temperatura podczas obróbki enzymem nie ma krytycznego znaczenia. Można stosować temperatury pomiędzy 20°C i 80°C, ale te ostatnie można stosować wyłącznie przez krótki okres czasu. W tym aspekcie stosuje się fosfolipazę według wynalazku mającą dobrą tolerancję na temperaturę i/lub niską na pH. Stosowanie temperatur od 30°C do 50°C jest optymalne. Okres traktowania zależy od temperatury i może być skracany wraz ze zwiększaniem temperatury. Czasy 0,1 do 10 godzin, lub 1 do 5 godzin są na ogół wystarczające. Reakcja zachodzi w reaktorze do odśluzowywania, który może być dzielony na etapy, jak opisano, np. w DE-A 43 39 556. W konsekwencji możliwe jest działanie ciągłe, wraz z działaniem okresowym. Reakcję można prowadzić w różnych stadiach temperaturowych. Na przykład, inkubacja może odbywać się przez 3 godziny w 40°C, a następnie przez 1 godzinę w 60°C. Jeśli reakcja zachodzi etapami, otwiera to również możliwość dostosowywania różnych wartości pH na poszczególnych stadiach. Na przykład, w pierwszym stadium pH roztworu może być dostosowane do 7, na przykład, a w drugim stadium do 2,5, przez dodawanie kwasu cytrynowego. W co najmniej jednym stadium, jednakże pH roztworu enzymu musi wynosić poniżej 4, lub poniżej 3. Jeśli pH będzie później dostosowywane poniżej tego poziomu, może to powodować pogorszenie efektu. W -149- konsekwencji, można dodawać kwas cytrynowy do roztworu enzymu, zanim ten ostatni zostanie zmieszany z olejem. [0477] Po ukończeniu obróbki enzymem, roztwór enzymu, wraz z produktami rozkładu zawartego w nim NHP może zostać oddzielony od fazy olejowej, okresowo lub w sposób ciągły, np. za pomocą wirowania. Jako że enzymy są charakteryzowane wysokim poziomem stabilności, a ilość produktów rozkładu zawartych w roztworze jest niewielka (mogą one wytrącać się jako gęsta zawiesina) tę samą fazę wodną enzymu można stosować kilka razy. Istnieje również możliwość uwolnienia enzymu z gęstej zawiesiny, patrz np. DE-A 43 39 556, tak, żeby było można ponownie stosować roztwór enzymu, który jest zasadniczo wolny od gęstej zawiesiny. W jednym aspekcie, w wyniku tego sposobi odśluzowywania otrzymuje się oleje, które zawierają mniej niż 15 ppm fosforu. Jednym z celów jest obniżenie zawartości fosforu poniżej 10 ppm; lub poniżej 5 ppm. Z zawartością fosforu poniżej 10 ppm, dalsza obróbka oleju według sposobu destylacyjnego odkwaszania jest prosta do wykonania. Szereg innych jonów takich, jak magnez, wapń, cynk, jak również żelazo, może być usuwana z oleju, np. poniżej 0,1 ppm. Zatem ten produkt posiada idealne wymogi wstępne do dobrej oporności na utlenianie podczas dalszej obróbki i przechowywania. [0478] Fosfolipazy i sposoby według wynalazku można również stosować do obniżania ilości składników zawierających fosfor w olejach roślinnych i zwierzęcych, jak opisano, np. w patencie EP 0513709. W tym sposób, zawartość składników zawierających fosfor, szczególnie fosfatydów takich, jak lecytyna, i zawartość żelaza w olejach roślinnych i zwierzęcych, które były wcześniej odśluzowywane, np. olej sojowy, jest obniżona poprzez rozkład enzymatyczny przy użyciu fosfolipazy A1, A2 lub B według ujawnienia. [0479] Fosfolipazy i sposoby według wynalazku można również stosować do rafinowania tłuszczy lub olejów, jak opisano, np. w patencie JP 06306386. Ujawnienie zapewnia sposoby do rafinowania tłuszczu lub oleju, obejmujące etap przekształcania fosfolipidu w tłuszczu lub oleju w rozpuszczalną w wodzie substancję, zawierającą grupę fosforową i usuwanie tej substancji. Działanie enzymu według wynalazku (PLC) jest stosowane do przekształcenia fosfolipidu do postaci substancji. Zatem możliwe jest rafinowanie tłuszczu lub oleju bez przeprowadzania etapu alkalicznego rafinowania, w którym wytwarza się odpady przemysłowe zawierające zasadową wodę odpadową i duże ilości oleju. Można osiągnąć poprawę wydajności, ponieważ utrata obojętnego tłuszczu lub oleju na skutek ucieczki wraz z odpadami może zostać zmniejszona do zera. W jednym aspekcie, substancje żywiczne przekształca się do rozpuszczalnych w wodzie substancji i usuwać jako rozpuszczalne w wodzie substancje, przez dodawanie enzymu według wynalazku mającego aktywność fosfolipazy C, w etapie odśluzowywania surowego oleju i prowadzenia traktowania enzymatycznego. W jednym aspekcie, fosfolipaza C według wynalazku ma aktywność, która tnie wiązania estrowe gliceryny i kwasu fosforowego w fosfolipidach. O ile jest to konieczne, sposób może obejmować przemywanie traktowanego enzymem oleju wodą lub kwasowym roztworem wodnym. W jednym aspekcie, enzym według ujawnienia dodaje się i poddaje reakcji z surowym olejem. Ilość użytej fosfolipazy C może wynosić 10 do 10,000 jednostek, lub około 100 do 2,000 jednostek, na 1 kg surowego oleju. -150- [0480] Fosfolipazy i sposoby według wynalazku można również stosować w sposobach odśluzowywania wodnego, jak opisano, np. w Dijkstra, Albert J., i wsp., Oleagineux, Corps Gras, Lipides (1998), 5(5), 367-370. W tym przykładowym sposobie, sposób odśluzowywania wodnego jest stosowany do produkcji lecytyny i do sposobów odśluzowywania na sucho, przy użyciu kwasu do odśluzowywania i ziemi do bielenia. Ten sposób może być ekonomicznie wykonalny jedynie dla olejów o niskiej zawartości fosfatydów, np. olej palmowy, oleje laurynowe itd. Dla olejów z nasion, mających wysoką zawartość NHP stosuje się sposób rafinowania za pomocą kwasu, dzięki któremu ten sposób jest prowadzony w olejarni, aby umożliwić usuwanie naturalnych żywic poprzez mączkę. W jednym aspekcie, ten rafinowany olej za pomocą kwasu jest potencjalną operacją ?wygładzającą? do wykonania przed fizycznym rafinowaniem. [0481] Fosfolipazy i sposoby według wynalazku można również stosować do sposobów odśluzowywania jak opisano, np. w Dijkstra, i wsp., Res. Dev. Dep., N.V. Vandemoortele Coord. Cent., Izegem, Belg. JAOCS, J. Am. Oil Chem. Soc. (1989), 66:1002-1009. W tym przykładowym sposobie, całkowity sposób odśluzowywania wymaga dyspergowania kwasu takiego jak H3PO4 lub kwas cytrynowy w oleju sojowym, umożliwiając uzyskanie czasu zetknięcia, a następnie mieszania zasady takiej, jak soda kaustyczna lub krzemian Na z emulsją typu kwas w oleju. To powoduje, że stopień zobojętniania jest na tyle niski, żeby uniknąć tworzenia się mydeł, co prowadziłoby do podwyższonych strat oleju. Później, olej przechodzi do separatora odśrodkowego, w którym usuwa się większość substancji śluzowych ze strumienia oleju, co daje fazę substancji śluzowych o minimalnej zawartości oleju. Strumień oleju jest następnie przekazywany do drugiego separatora odśrodkowego, do usunięcia wszystkich pozostałych substancji śluzowych, dla otrzymania rozcieńczonej fazy substancji śluzowych, która jest zawracana do obiegu. Odmywanie i suszenie lub wbudowane rafinowanie zasadowe kończy sposób. Po wdrożeniu kompletnego sposobu odśluzowywania, w porównaniu z klasycznym sposobem zasadowego rafinowania, uzyskuje się całkowitą poprawę wydajności o około 0,5%. Całkowicie odśluzowany olej może być później rafinowany zasadowo, bielony i odwaniany, lub bielony i rafinowany fizycznie. [0482] Fosfolipazy i sposoby według wynalazku można również stosować do usuwania nieulegających uwodnieniu fosfolipidów z oleju roślinnego, np. oleju sojowego, jak opisano, np. w Hvolby, i wsp., Sojakagefabr., Copenhagen, Den., J. Amer. Oil Chem. Soc. (1971) 48:503-509. W tym przykładowym sposobie odśluzowany wodą olej jest mieszany przy różnych ustalonych wartościach pH z roztworami buforowymi z oraz bez Ca++, odczynnikami wiążącymi Mg/Ca i środkami powierzchniowo czynnymi. Nieulegające uwodnieniu fosfolipidy można usuwać w stanie nieprzekształconym, jako składnik miceli lub mieszanych emulgatorów. Ponadto, nieulegające uwodnieniu fosfolipidy można usuwać poprzez konwersję do postaci zdysocjowanych, np. przez usuwanie Mg i Ca z fosfatydów, co można osiągnąć przez zakwaszanie lub przez traktowanie odczynnikami kompleksującymi Mg/Ca lub strącającymi Mg/Ca. Usuwanie lub konwersja chemiczna nieulegających uwodnieniu fosfolipidów mogą prowadzić do zmniejszonego tworzenia się emulsji i ulepszonego rozdziału odkwaszonego oleju z warstwy emulsji i sopstoku. -151- [0483] Fosfolipazy i sposoby według wynalazku można również stosować do odśluzowywania olejów roślinnych jak opisano np. w Buchold, i wsp., Frankfurt/Main, Niemcy. Fett Wissenschaft Technologie (1993), 95(8), 300-304. W tym przykładowym sposobie według wynalazku do odśluzowywania jadalnych olejów roślinnych, wodne zawiesiny enzymu według wynalazku, np. fosfolipazy A2, stosuje się do hydrolizowania kwasu tłuszczowego, związanego w pozycji sn2 fosfolipidu, co skutkuje 1-acylolizofosfolipidami, które są nierozpuszczalne w oleju i zatem bardziej podatne na fizyczny rozdział. Nawet dodawanie niewielkich ilości odpowiadających około 700 jednostek lecytazy/kg oleju powoduje powstawanie resztkowego stężenia P niższego niż 10 ppm, tak, że rafinowanie chemiczne można zastąpić fizycznym rafinowaniem, eliminując konieczność zobojętniania, rozszczepiania sopstoku i oczyszczania wody odpadowej. [0484] Fosfolipazy i sposoby według wynalazku można również stosować do odśluzowywania olejów roślinnych jak opisano, np. w EnzyMax, Dahlke, Klaus, Dept. GPDO, Lurgi Ol-Gas, Chemie, GmbH, Frankfurt, Niemcy. Oleagineux, Corps Gras, Lipides (1997), 4(1), 55-57. Ten przykładowy sposób oznacza sposób odśluzowywania do fizycznego rafinowania niemal dowolnego rodzaju oleju. Przez katalizowaną enzymatycznie hydrolizę, fosfatydy są przekształcane do rozpuszczalnych w wodzie lizofosfatydów, które są oddzielane od oleju przez wirowanie. Resztkowa fosfor zawartość w enzymatycznie odśluzowanym oleju może wynosić zaledwie 2 ppm P. [0485] Fosfolipazy i sposoby według wynalazku można również stosować do odśluzowywania olejów roślinnych jak opisano, np. w Cleenewerck, i wsp., N.V. Vamo Mills, Izegem, Belg. Fett Wissenschaft Technologie (1992), 94: 317-22; oraz Clausen, Kim; Nielsen, Munk. Novozymes A/S, Den. Dansk Kemi (2002) 83(2):24-27. Fosfolipazy i sposoby według wynalazku mogą inkorporować wstępne rafinowanie olejów roślinnych kwasami, jak opisano, np. w Nilsson-Johansson, i wsp., Fats Oils Div., Alfa-Laval Food Eng. AB, Tumba, Swed. Fett Wissenschaft Technologie (1988), 90 (11), 447-51; oraz Munch, Ernst W. Cereol Deutschland GmbH, Mannheim, Niemcy. Redaktor(-rzy): Wilson, Richard F. Proceedings of the World Conference on Oilseed Processing Utilization, Cancun, MX, Nov. 12-17, (2001), Meeting Date 2000, 17-20. [0486] Fosfolipazy i sposoby według wynalazku można również stosować do odśluzowywania olejów roślinnych jak opisano, np. w Jerzewska, i wsp., Inst. Przemyslu Miesnego i Tluszczowego, Warsaw, Pol., Tluszcze Jadalne (2001), 36(3/4), 97-110. W tym sposobie według wynalazku enzymatyczne odśluzowywanie uwodnionego oleju rzepakowego o niskiej zawartości kwasu erukowego zachodzi przez stosowanie fosfolipazy A2 według wynalazku. Enzym może katalizować hydrolizę wiązań estrowych kwasu tłuszczowego z centralnym atomem węgla ugrupowania glicerolu w fosfolipidach. Może on hydrolizować nieulegające uwodnieniu fosfolipidy do ich odpowiadających ulegających uwodnieniu lizozwiązków. Z nieoczyszczonym preparatem enzymu, można osiągnąć lepsze wyniki przy dodawaniu 2% preparatu przez 4 godziny (87% usuwania P). [0487] W kolejnym przykładowym sposobie według wynalazku do odśluzowywania oleju (lub sposobie odśluzowywania oleju przy użyciu enzymu według wynalazku), dodawany jest -152- kwasowy polimer, np. alginian lub pektyna. W tym sposobie odśluzowywania oleju według ujawnienia, dodaje się kwasowy polimer (np. kwas alginowy lub pektynę lub bardziej rozpuszczalną postać soli) do surowego oleju, z małą ilością wody (np. w zakresie od około 0,5 do 5%). W tym aspekcie, kwasowe polimery mogą obniżać i/lub rozrywać kompleksy fosfolipid-metal przez wiązanie wapnia i/lub magnezu w surowym oleju, tym samym ulepszając rozpuszczalność nieulegających uwodnieniu fosfolipidów. W alternatywnych aspektach, te fosfolipidy przemieszczą się do powierzchni międzyfazowej olej/woda lub przejdą do fazy wodnej, i będą przekształcane do diacyloglicerolu i odpowiadającego łańcucha bocznego, lub nienaruszony fosfolipid będzie usuwany przez późniejsze wirowanie jako składnik fazy ciężkiej. Obecność kwasowego polimeru w fazie wodnej może również zwiększyć gęstość fazy wodnej i skutkować ulepszonym rozdziałem fazy ciężkiej od fazy olejowej (lekkiej). [0488] Jeden przykładowy sposób według ujawnienia odśluzowywania oleju (lub sposób odśluzowywania oleju przy użyciu enzymu według wynalazku) zmienia procedurę odwaniania, aby otrzymać frakcję diacyloglicerolu (DAG). W alternatywnym aspekcie, o ile jest to konieczne lub pożądane, poniższe wspomagane enzymatycznie odśluzowywanie, warunki odwaniania (temperatura, ciśnienie, konfiguracja sprzętu do destylacji) mogą być modyfikowane, przy czym celem jest ulepszenie rozdziału wolnych kwasów tłuszczowych (FFA) od frakcji diacyloglicerolu/triacyloglicerolu, lub dalsze modyfikowanie, dla rozdzielenia diacyloglicerolu od frakcji triacyloglicerolu. W wyniku tych modyfikacji, przy użyciu tego sposobu według ujawnienia, możliwe jest otrzymanie FFA i diacyloglicerolu o jakości spożywczej, jeśli enzym według wynalazku (PLC) stosuje się do odśluzowywania jadalnego oleju w sposobie fizycznego rafinowania. [0489] W różnych aspektach, praktykowanie opisanych tu sposobów według wynalazku (lub przy użyciu enzymów według wynalazku), ma takie korzyści jak: zmniejszenie ilości lub usunięcie rozpuszczalnika i odzyskiwania rozpuszczalnika; niższe koszty kapitałowe; spadek kosztów rafinowania na późniejszym etapie, spadek zużycia chemikaliów, sprzęt, czas trwania procesu, zużycie energii (ciepła) i wody/generowanie wody odpadowej; produkowanie oleju o wyższej jakości; tłoczony za pomocą ekspelera olej może być stosowany bez rafinowania w niektórych aplikacjach gotowania i szybkiego przysmażania (ten tłoczony olej może mieć nadrzędną stabilność, barwę, charakterystykę zapachową i wysoką zawartość tokoferolu); produkcja wyższej jakości mączki; otrzymywanie niższej zawartości tłuszczu w mączce (obecnie, mączka wychodząca z prasy mechanicznej powoduje problemy z trawieniem u przeżuwaczy); otrzymywanie ulepszonych atrybutów żywieniowych ? obniżone poziomy glukozynolanów, tanin, sinapiny, kwasu fitynowego (jak opisano, np. w Technology and Solvents for Extracting Oilseeds and Nonpetroleum Oils, AOCS 1997). [0490] W jednym aspekcie, ujawnienie zapewnia sposoby rafinowania olejów roślinnych (np. oleju sojowego, oleju kukurydzianego, oleju z nasion bawełny, oleju palmowego, oleju arachidowego, oleju rzepakowego, oleju z nasion krokosza barwierskiego, oleju z nasion słonecznika, oleju z ziaren sezamu, oleju z otrębów ryżowych, oleju kokosowego lub oleju z rzepaku canola) i ich produktów ubocznych, oraz sposoby do odwaniania lecytyny, na -153- przykład, jak opisano w Patencie US Nr 6,172,248, lub US 6,172,247, w którym sposoby obejmują stosowanie co najmniej jednego enzymu według wynalazku, np. fosfolipazy C według wynalazku. Zatem ujawnienie zapewnia lecytynę i oleje roślinne zawierające co najmniej jeden enzym według wynalazku. W przykładowym sposobie rafinowania kwasem organicznym, olej roślinny jest łączony z rozcieńczonym wodnym roztworem kwasu organicznego i poddawany wysokiemu ścinaniu, do dokładnego dyspergowania roztworu kwasu w oleju. Powstałą mieszaninę kwasu i oleju miesza się z niskim ścinaniem przez czas wystarczający do sekwestracji substancji zanieczyszczających w uwodnionej fazie zanieczyszczeń, z wytwarzaniem oczyszczonej fazy oleju roślinnego. W tym przykładowym sposobie można stosować mieszalnik lub system recyklingu (np. zbiornik na wodę zawracaną do obiegu) i/lub zbiornik do przechowywania fosfatydu lub lecytyny, np. jak opisano w Patencie US Nry 4,240,972, US 4,049,686, US 6,172,247 lub US 6,172,248. Te sposoby można przeprowadzać jako procesy okresowe lub ciągłe. Surowy lub odśluzowany olej roślinny może być dostarczany ze zbiornika do przechowywania (np. poprzez pompę) i może być ogrzewany. Olej roślinny do oczyszczania może być surowym lub ?odśluzowanym? olejem. [0491] W jednym aspekcie, enzymy fosfatydyloinozytolo-PLC (PI-PLC) według ujawnienia są stosowane do odśluzowywania oleju roślinnego. Enzymy PI-PLC według wynalazku można stosować samodzielnie lub w kombinacji z innymi enzymami (na przykład enzymy PLC, PLD, fosfataza według ujawnienia) do poprawienia wydajności oleju podczas odśluzowywania olejów roślinnych (w tym soja, rzepak canola i słonecznik). PI-PLC może preferencyjnie przekształcać fosfatydyloinozytol do 1,2-diacyloglicerolu (DAG) i fosfoinozytolu, ale może również wykazywać aktywność wobec innych fosfolipidów, w tym fosfatydylocholiny, fosfatydyloetanoloaminy, fosfatydyloseryny lub kwasu fosfatydowego, lub ich kombinacji. Poprawa w wydajności będzie realizowana jako wzrost w ilości DAG w traktowanym enzymem oleju roślinnym i wzrost ilości obojętnego oleju, związany ze spadkiem w ilości oleju porywanego w mniejszych frakcjach substancji śluzowych, co jest skutkiem obróbki enzymem oleju roślinnego. Enzymatyczna obróbka nasion oleistych [0492] Wynalazek zapewnia kompozycje (np. enzymy) i sposoby do enzymatycznej obróbki nasion oleistych, w tym soi, rzepaku canola, kokosów, awokado i pasty z oliwek. W jednym aspekcie, te sposoby według wynalazku mogą podwyższyć wydajność oleju i poprawić jakość odżywczą otrzymanych mączek. W niektórych aspektach, enzymatyczna obróbka nasion oleistych przy użyciu enzymów i sposobów według wynalazku zapewni korzyści ekonomiczne i środowiskowe, jak również alternatywne technologie do ekstrakcji oleju i obróbki pożywienia do spożywania przez ludzi i zwierzęta. W alternatywnych aspektach, sposoby według ujawnienia obejmują stosowanie fosfolipaz według wynalazku, innych fosfolipaz, proteaz, fosfataz, fitaz, ksylanaz, amylaz (np. ?-amylaz), glukanaz (np. ?glukanaz), poligalakturonaz, galaktolipaz, celulaz, hemicelulaz, pektynaz i innych enzymów degradujących ścianę komórki roślinnej, jak również mieszanych preparatów enzymu i lizatów komórkowych. -154- [0493] W alternatywnych aspektach, sposoby według wynalazku można praktykować w połączeniu z innymi sposobami, np. enzymatycznym traktowaniem, np. karbohydrazami, w tym celulazą, hemicelulazą i innymi ubocznymi aktywnościami rozkładu, lub procesami chemicznymi, np. ekstrakcji oleju sojowego heksanem. Enzymatyczne traktowanie może podwyższyć ekstrahowalność oleju o 8-10% gdy traktowanie enzymatyczne prowadzi się przed ekstrakcją rozpuszczalnika. [0494] W alternatywnych aspektach, sposoby według wynalazku można praktykować z procesami ekstrakcji wodnej. Sposoby ekstrakcji wodnej mogą oznaczać technologie alternatywne do ekstrakcji oleju, czystsze dla środowiska. Niskie wydajności sposobów wodnej ekstrakcji można przezwyciężyć przy użyciu enzymów, które hydrolizują strukturalne polisacharydy tworzące ścianę komórkową nasion oleistych, lub które hydrolizują białka, które tworzą komórkę i błony ciałek lipidowych, np. stosując trawienie zawierające celulazę, hemicelulazę i/lub protopektynazę do ekstrakcji oleju z komórek soi. W jednym aspekcie, sposoby praktykuje się z enzymem według wynalazku, jak opisano w Kasai (2003) J. Agric. Food Chem. 51:6217-6222, gdzie zgłoszono, że najbardziej skutecznym enzymem do trawienia ściany komórkowej była celulaza. [0495] W jednym aspekcie, stosuje się w proteazy kombinacji ze sposobami według ujawnienia. Oceniano połączony efekt operacyjnych zmiennych i enzymatycznej aktywności proteazy i celulazy na wydajności ekstrakcji oleju i białka, w połączeniu z innymi parametrami sposobu takimi, jak stężenie enzymu, czas hydrolizy, rozmiar cząstek i stosunek substancji stałych do cieczy. W jednym aspekcie sposoby są praktykowane z enzymem według wynalazku, jak opisano w Rosenthal (2001) Enzyme and Microb. Tech. 28:499-509, gdzie zgłoszono, że stosowanie proteaz może dawać istotnie wyższe wydajności oleju i białka w porównaniu z kontrolą, gdy stosowano mąkę traktowaną ciepłem. [0496] W jednym aspekcie, całkowitą ekstrakcję przy użyciu kompletnego białka, pektyny i hemicelulozy można stosować w kombinacji ze sposobami według wynalazku. Komórka roślinna składa się z szeregu polisacharydów, często powiązanych z lub zastępowanych przez białka lub związki fenolowe. Większość tych węglowodanów jest jedynie częściowo trawiona lub słabo wykorzystywana przez enzymy trawienne. Rozerwanie tych struktur poprzez obróbkę lub enzymy rozkładające może polepszyć ich dostępność składników pokarmowych. W jednym aspekcie, sposoby praktykuje się z enzymem według wynalazku, jak opisano w Ouhida (2002) J. Agric. Food Chem. 50:1933-1938, gdzie zgłoszono, że osiągnięto istotny rozkład sojowej celulozowej ściany komórkowej (aż do 20%) po ekstrakcji za pomocą kompletnego białka, pektyny i hemicelulozy. [0497] W jednym aspekcie, sposoby według ujawnienia obejmują dodatkowo inkorporowanie różnych obróbek enzymatycznych w traktowaniu nasion, np. nasion rzepaku canola, te obróbki, zawierające stosowanie proteaz, celulaz i hemicelulaz (w różnych kombinacjach ze sobą nawzajem i z jednym lub więcej enzymem według ujawnienia). Na przykład, sposoby mogą obejmować enzymatyczne traktowanie nasion rzepaku canola, przy wilgotności 20 do 40, podczas inkubacji z enzymami, przed konwencjonalnym sposobem; jak opisano, np. w Sosulski (1990) Proc. Can. Inst. Food Sci. Technol. 3:656. Sposoby według ujawnienia mogą -155- dodatkowo obejmować inkorporowanie proteaz, ?-amylaz, poligalakturonaz (w różnych kombinacjach ze sobą nawzajem i z jednym lub więcej enzymami według ujawnienia) do hydrolizowania komórkowego materiału w mączce kokosowej i uwolnionym oleju kokosowym, który można odzyskiwać przez wirowanie, jak opisano, np. w McGlone (1986) J. of Food Sci. 51:695-697. Sposoby według ujawnienia mogą dodatkowo obejmować inkorporowanie pektynaz, ?-amylaz, proteazy, celulaz w różnych kombinacjach (ze sobą nawzajem i z jednym lub więcej enzymami według wynalazku), co skutkuje istotną poprawą wydajności (-70% w najlepszym przypadku) podczas enzymatycznego ekstrakcji oleju awokado, jak opisano, np. w Buenrostro (1986) Biotech. Letters 8(7):505-506. W sposobach według wynalazku ekstrakcji oliwy z oliwek, pastę z oliwek traktuje się celulazą, hemicelulazą, poligalakturonazą, pektyno-metylotransferazą, proteazą i ich kombinacjami (ze sobą nawzajem i z jednym lub więcej enzymami według wynalazku), jak opisano, np. w Montedoro (1976) Acta Vitamin. Enzymol. (Milano) 30:13. Oczyszczanie fitosteroli z olejów roślinnych [0498] Wynalazek zapewnia sposoby oczyszczania fitosteroli i triterpenów, lub steroli roślinnych, z olejów roślinnych. Fitosterole, które mogą być oczyszczane za pomocą fosfolipazy i sposobu według wynalazku obejmują ?-sitosterol, kampesterol, stigmasterol, stigmastanol, ?-sitostanol, sitostanol, desmosterol, chalinasterol, poriferasterol, clionasterol i brasykasterol. Sterole roślinne są ważnymi produktami rolnymi przeznaczonymi dla przemysłu zdrowotnego i żywieniowego. Zatem, fosfolipazy i sposoby według wynalazku są stosowane do wytwarzania emulgatorów dla producentów kosmetyków oraz steroidowych związków pośrednich i prekursorów do wytwarzania leków hormonalnych. Fosfolipazy i sposoby według wynalazku stosuje się do wytwarzania (np. oczyszczania) analogów fitosteroli i ich estrów, stosowanych jako środki obniżające poziom cholesterolu z korzyściami dla zdrowia kardiologicznego. Fosfolipazy i sposoby według wynalazku stosuje się do oczyszczania steroli roślinnych obniżających poziom cholesterolu we krwi poprzez hamowanie wchłaniania cholesterolu w świetle jelita. Fosfolipazy i sposoby według wynalazku stosuje się do oczyszczenia steroli roślinnych, które mają właściwości immunomodulujące w bardzo niskich stężeniach, w tym zwiększoną odpowiedź komórkowej limfocytów T i zdolności cytotoksyczne komórek NK przeciwko linii komórkowej nowotworu. Fosfolipazy i sposoby według wynalazku stosuje się do oczyszczenia steroli roślinnych stosowanych w leczeniu gruźlicy płuc, reumatoidalnego zapalenia stawów, zarządzaniu pacjentami zarażonymi HIV i hamowaniu stresu immunologicznego, np. u maratończyków. [0499] Fosfolipazy i sposoby według wynalazku stosuje się do oczyszczenia składników sterolowych obecnych we frakcji steroli towarowych olejów roślinnych (np. oleje kokosowy, rzepak canola, kakaowy, kukurydziany, bawełniany, z lnu, oliwy, palmy, orzeszków ziemnych, z otrąb ryżowych, z krokosza barwierskiego, sezamu, soi, słonecznika), takich, jak sitosterol (40,2-92,3 %), kampesterol (2,6-38.6 %), stigmasterol (0-31 %) i 5-awenasterol (1,5 -29 %). -156- [0500] Sposoby według wynalazku mogą włączać izolację steroli roślinnych w nasionach oleistych przez ekstrakcję rozpuszczalnika z mieszaniny chloroform-metanol, heksanem, chlorkiem metylenu lub acetonem, a następnie przez zmydlanie i oczyszczanie chromatograficzne dla uzyskania wzbogaconych całkowitych steroli. Alternatywnie, próbki roślinne można ekstrahować przez ekstrakcję płynem w stanie nadkrytycznym nadkrytycznym dwutlenkiem węgla aby uzyskać całkowite ekstrakty lipidowe, z których można wzbogacić i wyizolować sterole. Do późniejszego oznaczania i oceny ilościowej związków steroli surowy izolat można oczyszczać i oddzielać za pomocą różnorodnych technik chromatograficznych, w tym chromatografii kolumnowej (CC), chromatografii gazowej, chromatografii cienkowarstwowej (TLC), wysokosprawnej chromatografii cieczowej w normalnych fazach (HPLC), HPLC w fazach odwróconych i elektrochromatografią kapilarną. Spośród wszystkich chromatograficznych technik izolacji i separacji, procedury CC i TLC wykorzystują najbardziej dostępne, niedrogie i odpowiednie dla uprzątnięcia próbki, oczyszczenia, testów jakościowych i wstępnych szacunków steroli w badanych próbkach. [0501] Fitosterole traci się w olejach roślinnych jako produkty uboczne podczas sposobów rafinacji oleju jadalnego. Fosfolipazy i sposoby według wynalazku wykorzystują fitosterole wyizolowane z takich produktów ubocznych do wytwarzania produktów wzbogaconych w fitosterole wyizolowane z takich produktów ubocznych. Sposoby izolowania i oczyszczania fitosteroli według wynalazku mogą włączać produkty uboczne z przemysłu przetwórstwa olejów i mogą zawierać operacje takie, jak destylacja molekularna, ekstrakcja ciecz-ciecz i krystalizacja. [0502] Sposoby według wynalazku mogą włączyć procesy ekstrakcji lipidów, aby ekstrahować fitosterole. Na przykład, sposoby według wynalazku mogą używać rozpuszczalniki niepolarne jak heksan (powszechnie stosowany do większości rodzajów olejów roślinnych) ilościowo do ekstrakcji wolnych fitosteroli i estrów kwasów tłuszczowych fitosterylu. Glikozydy sterylu i acylowane resztami tłuszczowymi glikozydy sterolowe są tylko częściowo ekstrahowane heksanem, a zwiększenie polarności rozpuszczalnika dało wyższy procent ekstrakcji. Jedną procedurą, która może być stosowana jest metoda Bligh i Dyer z chloroformem-metanolem do ekstrakcji wszystkich klas lipidów steroli, w tym fosfolipidów. Jeden przykładowy sposób do zarówno jakościowego rozdzielania i ilościowej analizy klas lipidów fitosteroli obejmuje nastrzyknięcie ekstraktu lipidowego do układu HPLC. [0503] Fosfolipazy i sposoby według wynalazku można stosować do usuwania steroli z tłuszczów i olejów, jak opisano, np. w Patencie US Nr 6,303,803. Jest to sposób zmniejszania zawartości steroli z olejów i tłuszczów zawierających sterole. Jest to skuteczny i opłacalny sposób oparty na powinowactwie cholesterolu i innych steroli do amfipatycznych cząsteczek, które tworzą hydrofobowe, dwuwarstwy płynu takie, jak dwuwarstwy fosfolipidowe. Agregaty fosfolipidowe kontaktuje się z, na przykład, tłuszczem lub olejem zawierającym sterol w środowisku wodnym, a następnie miesza. Struktura molekularna tej zagregowanej mieszaniny fosfolipidów ma wysokie powinowactwo do cholesterolu i innych steroli, i może -157- selektywnie usunąć takie cząsteczki z tłuszczów i olejów. Mieszaninę wodną oddzielania miesza się przez czas wystarczający do selektywnego zmniejszenia zawartości steroli produktu tłuszczowego/olejowego przez podział sterolu na część agregatów fosfolipidów. Tłuszcz lub olej ze zmniejszonymi sterolami oddziela się następnie z mieszaniny wodnej oddzielania. Alternatywnie, odpowiednie frakcje wzbogacone w sterole można także izolować z mieszaniny wodnej oddzielania. Te etapy mogą być przeprowadzane w temperaturze otoczenia, koszty związane z ogrzewaniem są zminimalizowane, jak i możliwość degradacji termicznej produktu. Dodatkowo wymagana jest minimalna ilość sprzętu, a ponieważ wszystkie wymagane materiały są klasy spożywczej, metody te nie wymagają żadnych specjalnych środków ostrożności dotyczących obchodzenia się, składowania odpadów, lub skażenia produktu końcowego(-ych). [0504] Fosfolipazy i sposoby według wynalazku można stosować do usuwania steroli z tłuszczów i olejów, jak opisano, np. w Patencie US Nr 5,880,300. Agregaty fosfolipidowe są w kontakcie z, na przykład tłuszczem lub olejem zawierającym sterole w środowisku wodnym, a następnie mieszane. Po odpowiednim wymieszaniu, tłuszcz lub olej ze zmniejszonymi sterolami oddziela się od wodnej mieszaniny oddzielania. Alternatywnie, odpowiednio wzbogacony w sterole fosfolipid można także izolować z mieszaniny wodnej oddzielania. Oleje roślinne (np. warzywne) zawierają sterole roślinne (fitosterole), które mogą być również usunięte za pomocą sposobów według niniejszego wynalazku. Sposób ten ma zastosowanie do produktu tłuszczowego/olejowego w dowolnym etapie komercyjnego cyklu przetwarzania. Na przykład, sposób według wynalazku można stosować do rafinowanych, bielonych i dezodorowanych olejów (?olejów RBD?), lub dowolnego etapu sposobu przed osiągnięciem stanu RBD. Chociaż olej RBD może mieć zmienioną gęstość w porównaniu z olejem pre-RBD, sposoby można łatwo dostosować do olejów RBD albo pre-RBD, lub różnych innych produktów tłuszczowych/olejowych, przez zmianę zawartości fosfolipidów, składu fosfolipidów, stosunków fosfolipid:woda, temperatury, ciśnienia, warunków mieszania i warunków separacji, jak opisano poniżej. [0505] Alternatywnie, enzymy i sposoby według wynalazku można stosować do izolowania fitosteroli i innych steroli w pośrednich etapach przerobu oleju. Na przykład, wiadomo, że fitosterole są tracone podczas odwaniania olejów roślinnych. Zawierającą sterol frakcję destylatu z, na przykład, pośredniego etapu przetwarzania można poddawać procedurom ekstrakcji sterolu opisanym powyżej. Zapewnia to lecytynę wzbogaconą w sterol lub inny materiał fosfolipidowy, który można dalej przetwarzać w celu odzyskiwania ekstrahowanych steroli. Kompozycje Detergentów [0506] Wynalazek zapewnia kompozycje detergentów zawierające jedną lub więcej fosfolipaz według wynalazku, i sposoby wytwarzania i stosowania tych kompozycji. Ujawnienie inkorporuje wszystkie sposoby wytwarzania i stosowania kompozycji detergentów, patrz np. Patent US Nr 6,413,928; US 6,399,561; US 6,365,561; US 6,380,147. Kompozycje detergentów mogą stanowić jedno- i dwuczęściowe wodne kompozycje, niewodne ciekłe kompozycje, odlewane ciało stałe, postać granularną, postać rozdrobnionych cząstek, -158- prasowaną tabletkę, żel i/lub pastę i postać gęstej zawiesiny. Ujawnienie zapewnia również sposoby zdolne do szybkiego usuwania większych zanieczyszczeń pożywienia, warstw pozostałości żywności i innych pomniejszych kompozycji żywnościowych przy użyciu tych kompozycji detergentów. Fosfolipazy według wynalazku mogą ułatwić usuwanie plam za pomocą katalitycznej hydrolizy fosfolipidów. Fosfolipazy według wynalazku można stosować w detergentach do mycia naczyń, w detergentach do prania tkanin. [0507] Faktyczna zawartość aktywnego enzymu zależy od sposobu wytwarzania kompozycji detergentu, i nie ma krytycznego znaczenia, przy założeniu, że roztwór detergentu ma pożądaną aktywność enzymatyczną. W jednym aspekcie, ilość fosfolipazy obecnej w końcowym roztworze wynosi od około 0,001 mg do 0,5 mg na gram kompozycji detergentu. Określony enzym, wybrany do stosowania w sposobie i produktach według tego wynalazku zależy od warunków końcowej użyteczności, w tym postaci fizycznej produktu, użytego pH, użytej temperatury, i typów zanieczyszczeń, które mają zostać rozłożone lub zmienione. Enzym można dobierać tak, aby zapewnić optymalną aktywność i stabilność dla dowolnego danego zestawu warunków użyteczności. W jednym aspekcie, polipeptydy według niniejszego wynalazku są aktywne w zakresach pH od około 4 do około 12 i w zakresie temperatur od około 20°C do około 95°C. Detergenty według ujawnienia mogą zawierać środki powierzchniowo czynne - kationowe, półpoważne niejonowe lub obojnaczo-jonowe; lub ich mieszaniny. [0508] Fosfolipazy według niniejszego wynalazku można poddawać formulacji do postaci sproszkowanych i ciekłych detergentów, o pH pomiędzy 4,0 i 12,0 przy stężeniu około 0,01 do około 5% (korzystnie 0,1% do 0,5%) wagowych. Te kompozycje detergentów mogą zawierać również inne enzymy takie jak znane proteazy, celulazy, lipazy lub endoglikozydazy, jak również wypełniacze i stabilizatory. Dodawanie fosfolipazy według wynalazku do konwencjonalnych kompozycji czyszczących nie stwarza żadnych ograniczeń specjalnego przeznaczenia. Innymi słowy, jakakolwiek temperatura i pH odpowiednie dla detergentu są również odpowiednie dla niniejszych kompozycji, o ile pH pozostaje w obrębie powyższego zakresu, a temperatura wynosi mniej niż opisana temperatura denaturacji enzymu. Dodatkowo, polipeptydy według wynalazku można stosować w kompozycji czyszczącej bez detergentów, samodzielnie lub w kombinacji z wypełniaczami i stabilizatorami. [0509] Niniejsze ujawnienie zapewnia kompozycje czyszczące lub dezynfekujące, w tym kompozycje detergentów i/lub środków dezynfekujących do czyszczenia i/lub dezynfekcji powierzchni twardych, kompozycje detergentów do czyszczenia i/lub dezynfekowania tkanin, kompozycje do mycia naczyń, doustne kompozycje czyszczące, kompozycje czyszczące do protez i/lub roztwory czyszczące do szkieł kontaktowych. [0510] W jednym aspekcie, ujawnienie zapewnia sposób mycia wyrobu, obejmujący kontaktowanie wyrobu z fosfolipazą według wynalazku w warunkach wystarczających do mycia. Fosfolipazę według wynalazku można dołączać jako dodatek do detergentu. Kompozycję detergentu według wynalazku można, na przykład, poddawać formulacji jako kompozycję detergentu do prania ręcznego lub automatycznego, zawierającą fosfolipazę -159- według wynalazku. Dodatek do prania odpowiedni do wstępnego traktowania poplamionych tkanin może zawierać fosfolipazę według wynalazku. Kompozycja środka do zmiękczania tkanin może zawierać fosfolipazę według wynalazku. Alternatywnie, fosfolipazę według wynalazku można poddawać formulacji jako kompozycję detergentu do stosowania w ogólnych czynnościach czyszczenia twardych powierzchni do użytku domowego. W alternatywnych aspektach, dodatki do detergentów i kompozycje detergentów według wynalazku mogą zawierać jeden lub więcej innych enzymów takich, jak proteaza, lipaza, kutynaza, kolejna fosfolipaza, karbohydraza, celulaza, pektynaza, mannanaza, arabinaza, galaktanaza, ksylanaza, oksydaza, np. laktaza i/lub peroksydaza. Właściwości enzymu(-ów) według wynalazku są wybierane tak, żeby były kompatybilne z wybranym detergentem (tj. optymalne pH, zgodność z innymi enzymatycznymi i nieenzymatycznymi składnikami, itd.) i obecność enzymu(-ów) w skutecznej ilości. W jednym aspekcie, enzymy fosfolipazy według wynalazku stosuje się do usunięcia materiałów o przykrej woni z tkanin. Różne kompozycje detergentów i sposoby do ich wytwarzania, które można stosować w praktykowaniu ujawnienia opisano np. w Patencie US Nry 6,333,301; US 6,329,333; US 6,326,341; US 6,297,038; US 6,309,871; US 6,204,232; US 6,197,070; US 5,856,164. Przetwarzanie odpadów [0511] Fosfolipazy według wynalazku można stosować w przetwarzaniu odpadów. W jednym aspekcie ujawnienie zapewnia sposób trawienia odpadów stałych przy użyciu fosfolipaz według wynalazku. Sposoby mogą obejmować zmniejszanie masy i objętości zasadniczo nieprzetworzonych odpadów stałych. Odpady stałe można poddawać sposobowi enzymatycznego trawienia w obecności roztworu enzymatycznego (w tym fosfolipaz według wynalazku) w kontrolowanej temperaturze. Odpady stałe mogą być przekształcane do odpadów przeprowadzonych w stan ciekły i wszelkich resztkowych odpadów stałych. Powstałe odpady skroplone można oddzielać od wymienionych wszelkich resztkowych odpadów zestalonych. Patrz np. Patent US Nr 5,709,796. Detoksykacja [0512] Fosfolipazy (np. PLC, patatyny) mogą być stosowane w sposobach detoksykacji, np. do detoksykacji endotoksyn, np. kompozycji zawierających lipopolisacharydy (LPS), i, ujawnienie zapewnia sposoby detoksykacji przy użyciu co najmniej jednego enzymu według wynalazku, np. patatyny mającej sekwencję jak podano w SEQ ID NO:12 (kodowana przez SEQ ID NO:11), SEQ ID NO:14 (kodowana przez SEQ ID NO:13), SEQ ID NO:18 (kodowana przez SEQ ID NO:17), SEQ ID NO:26 (kodowana przez SEQ ID NO:25), SEQ ID NO:28 (kodowana przez SEQ ID NO:27), SEQ ID NO:34 (kodowana przez SEQ ID NO:33), SEQ ID NO:36 (kodowana przez SEQ ID NO:35), SEQ ID NO:44 (kodowana przez SEQ ID NO:43), SEQ ID NO:46 (kodowana przez SEQ ID NO:45), SEQ ID NO:56 (kodowana przez SEQ ID NO:55), SEQ ID NO:60 (kodowana przez SEQ ID NO:59), SEQ ID NO:66 (kodowana przez SEQ ID NO:65), SEQ ID NO:72 (kodowana przez SEQ ID NO:71), SEQ ID NO:78 (kodowana przez SEQ ID NO:77), SEQ ID NO:87 (kodowana przez SEQ ID NO:86), SEQ ID NO:88 (kodowana przez SEQ ID NO:87), SEQ ID NO:92 (kodowana przez SEQ ID NO:91), SEQ ID NO:96 (kodowana przez SEQ ID NO:95), SEQ -160- ID NO:100 (kodowana przez SEQ ID NO:99), SEQ ID NO:104 (kodowana przez SEQ ID NO:103), SEQ ID NO:126 (kodowana przez SEQ ID NO:125), SEQ ID NO:128 (kodowana przez SEQ ID NO:127), SEQ ID NO:132 (kodowana przez SEQ ID NO:131), SEQ ID NO:134 (kodowana przez SEQ ID NO:133), SEQ ID NO:136 (kodowana przez SEQ ID NO:135), lub SEQ ID NO:138 (kodowana przez SEQ ID NO:137). W jednym aspekcie, fosfolipazę według ujawnienia stosuje się do detoksykacji lipopolisacharydu (LPS). W jednym aspekcie, ta detoksykacja jest przez deacylowanie 2' i/lub 3' łańcuchów kwasów tłuszczowych z lipidu A. W jednym aspekcie, fosfolipid (np. PLC, patatyna) według ujawnienia stosuje się do hydrolizy 2'-lauroiloweg i/lub 3'-mirystoilowego łańcucha z lipidu, np. lipidu A (np. z endotoksyny bakteryjnej). W jednym aspekcie, sposób według ujawnienia stosuje się do zniszczenia endotoksyny, np. toksyny z bakterii Gram-ujemnych, jak z E. coli. W jednym aspekcie, fosfolipazę (np. PLC, patatyna) według ujawnienia stosuje się do łagodzenia skutków zatrucia toksyną (np. z trwającego zakażenia gram-ujemnego), lub, profilaktyczne do zapobiegania skutkom endotoksyny podczas zakażenia (np. zakażenie u zwierzęcia lub człowieka). W związku z tym, wynalazek zapewnia kompozycję farmaceutyczną zawierającą fosfolipazę (PLC) według wynalazku, oraz sposób z zastosowaniem hydrolazy według ujawnienia, do łagodzenia lub zapobiegania działaniom toksycznym lipopolisacharydu (LPS), np. podczas sepsy. Przetwarzanie żywności [0513] Fosfolipazy według wynalazku można używać do przetwarzania żywności, np. aby zmienić ich stabilność, okres trwałości, smak, teksturę, poprawić ich stan odżywczy i podobne. Na przykład, w jednym aspekcie, fosfolipazy według ujawnienia stosuje się do generowania kwaśnych fosfolipidów do kontrolowania gorzkiego smaku w żywności. [0514] W jednym aspekcie, ujawnienie zapewnia sposoby wytwarzania serów wykorzystujące fosfolipazy według wynalazku (a zatem, wynalazek zapewnia również sery zawierające fosfolipazy według wynalazku). W jednym aspekcie, enzymy według ujawnienia (np. fosfolipaza A, lizofosfolipaza lub ich kombinacja) stosuje się do przetwarzania serów dla poprawy smaku, w celu zwiększenia wydajności i/ lub do ?stabilizowania? serów, np. przez zmniejszenie tendencji do ?wyolejania? lub, w jednym aspekcie, enzymy według ujawnienia stosuje się do wyprodukowania sera z mleka do produkcji sera. Te sposoby według ujawnienia mogą zawierać dowolną metodę lub protokół, np. jak opisane, np. w Patentach US Nry 6,551,635, i 6,399,121, WO 03/070013, WO 00/054601. Na przykład, w jednym aspekcie, fosfolipazy według ujawnienia stosuje się do stabilizacji emulsji tłuszczowej w mleku lub kompozycjach zawierających mleko, np. śmietanę i stosuje się do stabilizowania kompozycji mlecznych, np. do wytwarzania śmietan lub śmietanowych płynów. W jednym aspekcie, ujawnienie zapewnia sposób polepszania smaku sera stosując co najmniej jeden enzym według ujawnienia, przy czym sposób ten obejmuje inkubowanie białka, tłuszczu i proteazy i lipazy w środowisku wodnym w warunkach, które wytwarzają lepszy smak sera (np. obniżona goryczy), np. jak opisano w WO 99/66805. W jednym aspekcie, fosfolipazy według ujawnienia stosuje się w celu poprawy smaku sera (np. twarogu) przez mieszanie z wodą, proteazą i lipazą (według ujawnienia) w podwyższonej temperaturze, np. pomiędzy -161- około 75°C do 95°C, jak opisano, np. w Patencie U.S. No. 4,752,483. W jednym aspekcie, fosfolipazy według ujawnienia stosuje się w celu przyspieszenia starzenia sera przez dodanie enzymu według ujawnienia (np. lipazy lub fosfolipazy) do sera (np. mleka do wytwarzania sera) przed dodaniem koagulanta do mleka, lub dodanie enzymu według ujawnienia do twarogu z solą przed sprasowaniem, np. jak opisano, np. w Patencie US Nr 4,707,364. W jednym aspekcie, lipazę według ujawnienia stosuje się do degradacji trójglicerydów tłuszczu mlecznego w celu uwolnienia wolnych kwasów tłuszczowych, powodując wzmocnienie smaku. Proteazę można również stosowany w każdym z tych sposobów według ujawnienia, patrz, np. Brindisi (2001) J. of Food Sci. 66:1100-1107. W innym aspekcie, kombinację esteraz, lipaz, fosfolipaz i/lub proteaz można stosować w tych albo dowolnych sposobach według ujawnienia. [0515] W jednym aspekcie, fosfolipaza według ujawnienia jest stosowana w celu zmniejszenia zawartości składników fosforowych w produkcie żywnościowym, np. oleju takim, jak olej roślinny o wysokiej nieulegającej uwodnieniu zawartości fosforu, np. jak opisano w WO 98/26057. Inne zastosowania dla fosfolipaz według wynalazku [0516] Fosfolipazy według wynalazku można także stosować do zbadania układ sygnalizacji fosfoinozytydu (PI); do diagnozowania, prognozowania i rozwoju terapii zaburzeń dwubiegunowych (patrz, np. Pandey (2002) Neuropsychopharmacology 26:216-228); jako przeciwutleniacze; jako zmodyfikowanej fosfolipidy; jako środki pieniące i do żelowania; do generowania angiogenezy lipidów dla waskularyzujących tkanek; do identyfikacji fosfolipazy, np. modulatory (agoniści lub antagoniści) PLA, PLB, PLC, PLD i/lub patatyny, np. inhibitory, do zastosowania jako środki przeciwnowotworowe, środki przeciwzapalne i jako środki przeciwbólowe. Mogą one być stosowane do wytwarzania kwaśnych fosfolipidów do kontrolowania gorzkiego smaku żywności i leków. Mogą być one stosowane do oczyszczania tłuszczu. Mogą one być wykorzystywane do identyfikacji inhibitorów peptydów w leczeniu chorób wirusowych, zapalnych, alergicznych i układu sercowo-naczyniowego. Mogą one być wykorzystywane do wytwarzania szczepionek. Mogą one zostać wykorzystane do wytwarzania glicerydów wielonienasyconych kwasów tłuszczowych i fosfatydylogliceroli. [0517] Fosfolipazy według ujawnienia, na przykład enzymy PLA i PLC, stosuje się do generowania immunotoksyn oraz różnych środków terapeutycznych dla terapii przeciwnowotworowych. [0518] Fosfolipazy według wynalazku można stosować w połączeniu z innymi enzymami, do odbarwiania (tj. usuwania chlorofilu) i w detergentach (patrz powyżej), np. w połączeniu z innymi enzymami (np. lipazy, proteazy, esterazy, fosfatazy). Na przykład, w dowolnym przypadku stosowania PLC, PLD i fosfataza mogą być stosowane w kombinacji, aby dać ten sam rezultat, co PLC samodzielnie. [0519] Poniższa tabela zestawia kilka przykładowych sposobów i formulacji według ujawnienia: -162- Przykładowy sposób według wynalazku Cel Zastosowanie chemiczne w odśluzowywaniu oleju za pomocą PLC Nie stosuje się kwasu Eliminacja chemikaliów Nie stosuje się substancji żrących Eliminacja chemikaliów Zakres stosowania kwasu i substancji Redukcja chemiczna/sposób odśluzowywania żrącej (brak nadmiaru, w nadmiarze) alternatywny przykład wykonania Inne rodzaje kwasu i substancji żrącej Sposób odśluzowywania alternatywne przykłady wykonania Wpływ wody w odśluzowywaniu oleju za pomocą PLC Stosowanie żelu krzemionkowego Zastąpienie etapu odmywania wodą Stosowanie środka usuwającego wodę Eliminacja wody w końcowym produkcie Wpływ mniejszej ilości wody podczas Eliminacja wody w końcowym produkcie traktowania kaustycznego Minimalna zawartość wody (<5%) Eliminacja wody w końcowym produkcie Maksymalna zawartość wody (>5%) Sposób alternatywny Sposób odśluzowywania alternatywny Profile wilgotności w odśluzowywaniu za przykład wykonania pomocą PLC Wrażliwość oleju na zawartość wody w Sposób odśluzowywania alternatywny przykład odśluzowywaniu za pomocą PLC wykonania In situ usuwanie wolnych kwasów tłuszczowych, FFA Dodawanie środka chelatującego FFA Sposób odśluzowywania alternatywny przykład wykonania; poprawia warunki w oleju ochrona przed zepsutymi ziarnami Wpływ schematu mieszania na odśluzowywanie oleju za pomocą PLC Odśluzowywanie PLC z minimalnym Ochrona enzymu przed denaturacją indukowaną mieszaniem mieszaniem, oszczędność energii -163- Odśluzowywanie PLC z wyjściowym Sposób odśluzowywania alternatywny przykład mieszaniem ścinającym, a następnie wykonania mieszanie mieszadłem łopatkowym Kolejność dodawania chemikaliów Kolejność dodawania: enzym-woda, potem kwas, a następnie substancja żrąca Umożliwienie funkcjonowania PLC przed ekspozycją na kwas i/lub substancję żrącą, powodowanie potencjalnej inaktywacji PLC w związku z pH lub chelatowaniem metali Sposób odśluzowywania oleju PLC alternatywne przykłady wykonania co do temperatury i czasu Etap obróbki enzymem (czas): <60 min, Sposób odśluzowywania alternatywny przykład korzystnie <30 min wykonania Etap obróbki enzymem (temperatura): 50- Sposób odśluzowywania alternatywny przykład 70°C, prawdopodobnie <50°C (np. RT) wykonania Korzyści z odśluzowywania oleju za pomocą PLC Wytwarzanie sopstoku o minimalizowanej Sposób odśluzowywania alternatywny przykład zawartości PL i wzbogaconego w wykonania rozpuszczalne w wodzie estry fosforanowe Zmniejszona ilość obojętnego oleju w Sposób odśluzowywania alternatywny przykład substancjach śluzowych, dzięki wykonania stosowaniu PLC Sposób generowania wzrostu ilości DAG Sposób odśluzowywania alternatywny przykład w olejach roślinnych (np. 1,3-DAG) wykonania Korzyści ze stosowania olejów roślinnych Przykładowa korzyść związana z produktem o podwyższonym DAG w porównaniu z innymi olejami, ze względu na korzyści zdrowotne Badanie sposobu odśluzowywania, który Sposób odśluzowywania alternatywny przykład nie pozostawia aktywności PLC w oleju wykonania /poprawa regulacji Badanie sposobu odśluzowywania, który Sposób odśluzowywania alternatywny przykład nie pozostawia wykrywalnego białka PLC wykonania /poprawa regulacji -164- w oleju Stosowanie enzymu do produkcji DAG z Przykładowa korzyść związana z produktem masy lecytynowych substancji śluzowych Stosowanie PLC z olejami specjalnymi Przykładowa korzyść związana z produktem (wzbogacone w PA, PI) Stosowanie enzymów specyficznych dla Sposób odśluzowywania alternatywny przykład PA/PI (np. 596ES2/specyficzny dla PI) wykonania Stosowanie enzymów specyficznych dla Sposób odśluzowywania alternatywny przykład PA/PI (np. 596ES2/specyficzny dla PI) + wykonania enzymów specyficznych dla PC/PE; wpływ kolejności dodawania Proces okresowy lub ciągły Sposób odśluzowywania alternatywny przykład wykonania Stosowanie ponownego zawieszania Sposób odśluzowywania alternatywny przykład traktowanych PLC substancji śluzowych wykonania dla dalszych czynności odśluzowywania oleju Równowaga masowa dla DAG, FFA, P, Sposób odśluzowywania alternatywny przykład metali, obojętnego oleju w substancjach wykonania śluzowych Różne Dodawanie PLC do płatkowanych nasion Alternatywny przykład wykonania sposobu oleistych przed wyciskaniem Oznaczenia odśluzowywania na małą Sposób odśluzowywania alternatywny przykład skalę wykonania Stosowanie innych enzymów do Sposób odśluzowywania alternatywny przykład zmniejszenia masy substancji śluzowych wykonania (np. enzym PYROLASE?, chlorofilaza, peroksydaza, lipaza, lakkaza, mannanaza, proteaza, laktaza, amylaza, itd. lub ich kombinacje) Stosowanie związku lepszego rozdziału śluzowych do ułatwiania Sposób odśluzowywania alternatywny przykład oleju/substancji wykonania Utwardzanie się substancji śluzowych w Sposób odśluzowywania alternatywny przykład oleju traktowanym PLC wykonania -165- Glikozylowane/deglikozylowane warianty Sposób odśluzowywania alternatywny przykład fosfolipazy wykonania Przykładowe wynalazku formulacje Przykładowe ciekłe wpływające na stabilność według Cel formulacje Stosowanie związków w celu podwyższenia stabilności PLC w różnych warunkach pH i zakresach temperatur (poliole, sole, metale...) Stabilizacja enzymu dla maksymalnej produkcji DAG, prawdopodobnie do zmieniania specyfiki substratu lub ukierunkowywania tworzenia się produktu ku typowi 1,3-DAG Stosowanie systemu dostarczania Stabilizacja enzymu dla maksymalnej produkcji hydrofobowego dla PLC (liposomy, DAG, prawdopodobnie do zmieniania specyfiki uwodniony enzym w kropelkach substratu lub ukierunkowywania tworzenia się rafinowanego oleju) produktu ku typowi 1,3-DAG Formulacja stała wpływająca na stabilność Stosowanie różnych PLC, systemów nośników fosfolipazy (żywice unieruchamiające, macierze porowate, żele, granulki, proszki, tabletki, pęcherzyki/micele, kapsułkowanie, strukturyzowane ciecze itp.) do stabilizowania fosfolipazy i koenzymów Stabilizacja enzymu(ów) i łatwość rozdziału enzymu od oleju lub fazy substancji śluzowych po odśluzowywaniu; Zdolność do recyklingu preparatu enzymu; fizyczny rozdział fazy enzymu podczas obróbki oleju; atakowanie PI/PA przez PLC Stosowanie materiałów odpadowych Obniżenie kosztów składników formulacji, odśluzowywania (składniki substancji lepsza mieszalność enzymu z olejem, śluzowych, łupiny nasion) do formulacji termostabilizacja enzymu PLC Przykładowa formulacja i sposoby na zwiększanie aktywności Stosowanie substancji chemicznej lub Szybszy czas enzymu do ułatwienia lepszego odśluzowywania/zmniejszenie dyspergowania enzymu w oleju (np. chemikaliów matryca musująca itp.) Powtórne stosowanie żywic /enzymu do Możliwość recyklingu enzymu dalszych reakcji odśluzowywania reakcji/sposobu zużycia -166- Stosowanie formulacji, które nasilają Szybszy czas reakcji/sposobu odśluzowywania segregację lub wychwytywanie enzymu /zmniejszenie zużycia chemikaliów PL do hydrolizy Stosowanie wielu uwzględniających PLC specyficznościach PL formulacji Uniwersalność sposobu; różne enzymy mogą o różnych wymagać różnych formulacji lub mogą być dodawane na różnych stadiach w sposobie Stosowanie wielu formulacji, aby Ochrona aktywności PLC w zapobiec inaktywacji jednej PLC przez wieloenzymatycznym formacie przykładu składnik do przygotowywania kolejnej wykonania PLC o innej specyfice substratowej Stosowanie wielu formulacji, aby Ochrona aktywności PLC w zapobiec inaktywacji jednej PLC przez wieloenzymatycznym formacie przykładu składnik do przygotowywania kolejnego wykonania enzymu (hydrolaza, oksydaza) Stosowanie okresowo dodawania Ochrona enzymu przed denaturacją indukowaną substancji żrących jak w uwalnianiu mieszaniem, oszczędność energii czasowym dodawanej formulacji substancji żrącej Inaktywowanie i Modulowanie Aktywności Enzymów przez Glikozylację [0520] Ujawnienie zapewnia sposoby obejmujące stosowanie technologii rekombinacji do wytwarzania i eksprymowania enzymów lub innych białek o aktywności biologicznej, np. szkodliwych lub toksycznych enzymów, (przy czym enzymy lub inne białka nie są normalnie glikozylowane) w nieaktywnej lub mniej aktywnej postaci, ale z możliwością ponownej aktywacji. Sposób obejmuje dodawanie jednego lub więcej miejsc glikozylacji (np. Nglikozylacja lub O-glikozylacja) do enzymów lub innych białek o aktywności biologicznej (np. enzym według niniejszego wynalazku) przez konstruowanie sekwencji kodującej inkorporującej nowe miejsce glikozylacji; eksprymowanie wariantowych sekwencji kodujących w eukariotycznych komórkach lub równorzędnym systemie, konstruowanym lub in vitro, zdolnym do glikozylacji potranslacyjnej. Na przykład, sekwencja 3 aminokwasów NXS/T to miejsce glikozylacji w komórkach eukariotycznych, komórki prokariotyczne gonie stosują. Zatem ujawnienie zawiera dodawanie co najmniej jednej sekwencji 3 aminokwasów NXS/T do białka tak, że jego aktywność jest obniżona lub ulega inaktywacji ze względu na glikozylację potranslacyjną. [0521] Glikozylacja może skutkować dodaniem 2 cząsteczek N-acetyloglukozaminy (NGlucNac) do reszty N. Późniejsze addycje mogą być specyficzne dla organizmu. U większości gatunków następnie dodawane są cukry mannozy (Mann) do nGlucNac, przy czym liczba reszt Mann wynosi od 10 do 100. U niektórych gatunków dodawany jest kwas sialowy. W Pichia po dodaniu nGlucNac może zostać dodanych 10 do 25 reszt Mann. -167- [0522] Te sposoby obejmują stosowanie dowolnego enzymu deglikozylującego lub zestawu enzymów, z których wiele mogło zostać zidentyfikowane i/lub są dostępne w handlu. Na przykład, enzym endoglikozydazy H przecina przy ostatnim NGlucNac pozostawiając jedno NGlucNac nadal dołączone do reszty N. Enzym PNGaza F odcina wszystkie cukry i przekształca łańcuch aminokwasowy reszty N w grupę hydroksylową, co skutkuje tym, że aminokwas N staje się aminokwasem D ? asparaginianem w enzymie. Zatem sposoby obejmują stosowanie endoglikozydazy H i/lub PNGazy F lub równorzędnych enzymów in vivo lub in vitro, w celu ponownej aktywacji, częściowo lub w pełni, konstruowanych, ?przejściowo inaktywowanych? białek. [0523] Sposób obejmuje nakierowywanie enzymów lub innych polipeptydów na szlak wydzielniczy gospodarza, tak, żeby enzymy były glikozylowane. Nowe miejsca glikozylacji są zaprojektowane tak, że glikozylacja inaktywuje enzym lub modyfikuje jego aktywność, np. obniża jego aktywność lub inaczej modyfikuje aktywność takie, jak blokowanie miejsca wiązania substratu. Ponieważ enzym jest nieaktywny lub mniej aktywny, szkodliwe lub toksyczne enzymy mogłyby być eksprymowany na wyższych poziomach, skoro negatywne skutki ich aktywności nie są już dłużej ograniczeniem tego, jak wiele białka może się gromadzić w komórkach gospodarza. Nieaktywny, glikozylowany enzym może zostać ponownie aktywowany (częściowo lub w pełni) przez usuwanie cukrów, np. przy użyciu dostępnych w handlu enzymów deglikozylujących, na przykład, przez usuwanie cukrów in vitro, lub usuwanie cukrów in vivo przy użyciu podejść do konstruowania całej komórki. [0524] W jednym aspekcie, dodaje się eukariotyczne miejsce docelowe glikozylacji takie, jak NXS/T do dowolnego białka, na przykład, enzymu według wynalazku. Umożliwia to znawcy dodawanie miejsc glikozylacji do przedmiotowego białka, z oczekiwaniem, że przekształci to białko na takie, które jest czasowo nieaktywne, gdy to białko jest glikozylowane, przez eksprymowanie tego białka w komórce eukariotycznego gospodarza i nakierowywanie białka na szlak wydzielniczy komórki gospodarza. [0525] Zatem ujawnienie zapewnia sposoby do produkcji enzymów, które normalnie są zbyt szkodliwe lub toksyczne, by były tolerowane w dużych ilościach przez komórkę gospodarza. Efekt może być tymczasowy, jako że istnieje możliwość regeneracji aktywnego enzymu (przez deglikozylację, np. przez modyfikację potranslacyjną/deglikozylację) do dalszych prac wymagających aktywnego enzymu. [0526] W jednym aspekcie, ujawnienie zapewnia sposoby wytwarzania i eksprymowania białka mającego aktywność biologiczną, która to aktywność jest czasowo inaktywowana przez glikozylację, obejmujące: (a) zapewnianie kwasu nukleinowego kodującego białko mające aktywność biologiczną, przy czym białko nie jest naturalnie glikozylowane; (b) wprowadzanie co najmniej jednej sekwencji kodującej motyw glikozylacji do kodującego białko kwasu nukleinowego, przy czym glikozylowana postać białka jest nieaktywna; (c) wprowadzanie docelowej sekwencji do białka tak, że jest ono nakierowywane na szlak wydzielniczy komórki gospodarza, przy czym komórka gospodarza jest zdolna do rozpoznawania motywu glikozylacji i glikozylowania białka; i (d) eksprymowanie modyfikowanego kwasu nukleinowego w komórce gospodarza. W jednym aspekcie, sposób -168- obejmuje dodatkowo deglikozylowanie eksprymowanego białka, tym samym ponowne aktywowanie aktywności białka, np. enzymu takiego, jak enzym według ujawnienia. W jednym aspekcie, komórka gospodarza oznacza komórkę eukariotyczną. W jednym aspekcie, inaktywowane eksprymowane rekombinowane białko ponownie aktywowuje się in vitro przez deglikozylację, chemiczną lub enzymatyczną. [0527] Określanie lokalizacji jednego lub więcej motywów glikozylacji do tymczasowego inaktywowania białka wymaga jedynie rutynowych sposobów do wytwarzania wariantów kodujących białko kwasów nukleinowych, np. przez GSSM?, i rutynowych protokołów badań przesiewowych, np. oznaczeń aktywności lub wiązania. [0528] Enzym, którego aktywność była szkodliwa dla komórki gospodarza stał się nieaktywny ze względu na glikozylację. Ponieważ był nieaktywny mógł akumulować na o wiele wyższych poziomach w eukariotycznych komórkach gospodarza. Ponieważ nie był już aktywny, nie był już dłużej zdolny do wywierania swojego negatywnego wpływu. Inaktywacja toksycznego enzymu była tymczasowa, ponieważ deglikozylacja enzymu przy użyciu EndoH lub PNGase F skutkowała całkowitym przywróceniem normalnej aktywności enzymu. Duże ilości glikozylowanego, nieaktywnego enzymu gromadziły się w pożywce, co sugeruje, że był on dobrze tolerowany przez gospodarza w postaci nieaktywnej. PRZYKŁADY PRZYKŁAD 1: PROGRAM IDENTYCZNOŚCI SEKWENCJI BLAST STOSOWANY DO PROFILOWANIA [0529] Ten przykład opisuje przykładowy program do badania identyczności sekwencji, aby określić czy kwas nukleinowy pozostaje w obrębie zakresu wynalazku. Stosuje się program NCBI BLAST 2.2.2, domyślne opcje to blastp. Stosowano wszystkie wartości domyślne za wyjątkiem domyślnych ustawień filtrowania (tj. wszystkie parametry ustawiono jako domyślne poza filtrowaniem, które jest ustawione na OFF); zamiast tego stosuje się ustawienie ?-F F?, które unieruchamia filtrowanie. Stosowanie domyślnych ustawień filtrowania często powoduje naruszenia Karlina-Altschula ze względu na małą długość sekwencji. Wartości domyślne stosowane w tym przykładzie: ?Filter for low complexity: ON > Word Size: 3 > Matrix: Blosum62 > Gap Costs: Existence:11 > Extension:1? [0530] Inne domyślne ustawienia to: filter for low complexity OFF, word size 3 for protein, BLOSUM62 matrix, gap existence penalty -11 i gap extension penalty - 1. Opcja ?-W? została ustawiona domyślnie jako 0. Oznacza to, że, o ile nie zmieni się ustawień, domyślny rozmiar frazy wynosi 3 dla białek i 11 dla nukleotydów. Ustawienia były jak następuje: <> -169- > -------------------------------------------------------------------------> blastall arguments: > > -p Program Name [String] > -d Database [String] > default = nr > i Query File [File In] > default = stdin > -e Expectation value (E) [Real] > default = 10,0 > -m alignment view options: > 0 = pairwise, > 1 = query-anchored showing identities, > 2 = query-anchored no identities, > 3 = flat query-anchored, show identities, > 4 = flat query-anchored, no identities, > 5 = query-anchored no identities and blunt ends, > 6 = flat query-anchored, no identities and blunt ends, > 7 = XML Blast output, > 8 = tabular, > 9 tabular with comment lines [Integer] > default = 0 > -o BLAST report Output File [File Out] Optional > default = stdout > -F Filter query sequence (DUST with blastn, SEG with others) [String] > default = T > -G Cost to open a gap (zero invokes default behavior) [Integer] > default = 0 > -E Cost to extend a gap (zero invokes default behavior) [Integer] > default = 0 > -X X dropoff value for gapped alignment (in bits) (zero invokes default -170- > behavior) [Integer] > default = 0 > -I Show GI's in deflines [T/F] > default = F > -q Penalty for a nucleotide mismatch (blastn only) [Integer] > default = -3 > -r Reward for a nucleotide match (blastn only) [Integer] > default = 1 > -v Number of database sequences to show one-line descriptions for (V) > [Integer] > default = 500 > -b Number of database sequence to show alignments for (B) [Integer] > default = 250 > -f Threshold for extending hits, default if zero [Integer] > default = 0 > -g Perform gapped alignment (not available with tblastx) [T/F] > default = T > -Q Query Genetic code to use [Integer] > default = 1 > -D DB Genetic code (for tblast[nx] only) [Integer] > default = 1 > -a Number of processors to use [Integer] > default = 1 > -O SeqAlign file [File Out] Optional > -J Believe the query defline [T/F] > default = F > -M Matrix [String] > default = BLOSUM62 > -W Word size, default if zero [Integer] > default = 0 > -z Effective length of the database (use zero for the real size) -171- > [String] > default = 0 > -K Number of best hits from a region to keep (off by default, if used a > value of 100 is recommended) [Integer] > default = 0 > -P 0 for multiple hits 1-pass, 1 for single hit 1-pass, 2 for 2-pass > [Integer] > default = 0 > -Y Effective length of the search space (use zero for the real size) > [Real] > default = 0 > -S Query strands to search against database (for blast[nx], and > tblastx). 3 is both, 1 is top, 2 is bottom [Integer] > default = 3 > -T Produce HTML output [T/F] > default = F > -1 Restrict search of database to list of GI's [String] Optional > -U Use lower case filtering of FASTA sequence [T/F] Optional > default = F > -y Dropoff (X) for blast extensions in bits (0,0 invokes default > behavior) [Real] > default = 0,0 > -Z X dropoff value for final gapped alignment (in bits) [Integer] > default = 0 > -R PSI-TBLASTN checkpoint file [File In] Optional > -n MegaBlast search [T/F] > default = F > -L Location on query sequence [String] Optional > -A Multiple Hits window size (zero for single hit algorithm) [Integer] > default = 40 PRZYKŁAD 2: SYMULACJA ODŚLUZOWYWANIA REGULOWANEGO PRZEZ PLC -172- [0531] Ten przykład opisuje symulację odśluzowywania regulowanego za pomocą fosfolipazy C (PLC). [0532] Ze względu na jej słabą rozpuszczalność w wodzie, fosfatydylocholinę (PC) pierwotnie rozpuszczono w etanolu (100 mg/ml). Po początkowego testowania przygotowano roztwór podstawowy PC w 50 mM kwasu 3-morfolinopropanosulfonowego lub 60 mM kwasu cytrynowego/NaOH w pH 6. Roztwór podstawowy PC (10 ml, 1 m/ml) dodawano do 500 ml rafinowanego oleju sojowego (2% woda) w probówce Eppendorf. W celu wygenerowania emulsji zawartość probówki mieszano przez 3 minuty przez worteksowanie (patrz Fig. 5A). Olej i fazę wodną rozdzielano przez wirowanie przez 1 min przy 13,000 rpm (Fig. 5B). Probówki reakcyjne inkubowano wstępnie w pożądanej temperaturze (37°C, 50°C lub 60°C) i dodawano 3 ml PLC z Bacillus cereus (0,9 U/ml) do fazy wodnej (Fig. 5C). Zanikanie PC analizowano za pomocą TLC przy użyciu chloroformu/metanolu/wody (65:25:4) jako systemu rozpuszczalników (patrz np. Taguchi (1975) supra) i wizualizowano po ekspozycji na pary I2. [0533] Figura 5 schematycznie ilustruje model dwufazowy systemu do symulacji regulowanego PLC odśluzowywania. Fig. 5A: Generowanie emulsji przez mieszanie surowego oleju z 2% wodą, dla uwodnienia zanieczyszczających fosfatydów (P). Fig. 5B: olej i fazę wodną rozdzielano po wirowaniu i dodawano PLC do fazy wodnej, która zawiera strącone fosfatydy (?substancje śluzowate?). Hydroliza PLC zachodzi w fazie wodnej. Fig. 5C: Przebieg czasowy reakcji monitorowano przez wycofywanie porcji z fazy wodnej i analizowanie ich za pomocą TLC. PRZYKŁAD 3: EKSPRESJA FOSFOLIPAZ [0534] Ten przykład opisuje konstrukcję komercyjnego szczepu produkcyjnego według wynalazku, który może eksprymować liczne fosfolipazy (w tym enzymy według wynalazku). W celu wyprodukowania wieloenzymatycznej formulacji, odpowiedniej do stosowania w odśluzowywaniu olejów roślinnych o jakości spożywczej (w tym soja, rzepak canola i słonecznik), można generować rekombinowany szczep do ekspresji, który eksprymuje dwie różne sekwencje fosfolipazy w tym samym gospodarzu do ekspresji. Na przykład, ten szczep można konstruować tak, żeby zawierał jedną lub więcej kopii genu PLC i jedną lub więcej kopii genu fosfatydyloinozytolu-PLC. Te geny mogą występować na jednym plazmidzie, wielu plazmidach, lub geny mogą być wprowadzane do genomu gospodarza do ekspresji przez homologiczną rekombinację. Gdy geny są wprowadzane przez homologiczną rekombinację, geny można wprowadzać do pojedynczej lokalizacji w genomie gospodarza, jako kasetę DNA do ekspresji, która zawiera jedną lub więcej kopii obu genów. Alternatywnie, jedną lub więcej kopii każdego genu można wprowadzać do odrębnych miejsc na chromosomie gospodarza. Ekspresja tych dwóch sekwencji genu może być napędzana przez jeden typ promotora, lub każda sekwencja genu może być napędzana przez niezależny promotor. W zależności od liczby kopii każdego genu i typu promotora, końcowy szczep będzie eksprymować różne proporcje każdego typu enzymu. Szczepy do ekspresji można konstruować przy użyciu dowolnego Bacillus (np. B. cereus) lub Streptomyces, E. coli, S. -173- pombe, P. pastoris, lub innych Gram-ujemnych, Gram-dodatnich lub układów ekspresyjnych drożdży. [0535] W jednym aspekcie, ujawnienie zapewnia dwu-enzymowy system do odśluzowywania oleju sojowego, w którym co najmniej jeden enzym oznacza enzym według wynalazku. PLC plus PI-PLC daje więcej DAG niż każdy enzym samodzielnie. Jednakże, oba enzymy dają więcej DAG niż jakikolwiek z enzymów próbki kontrolnej. W jednym aspekcie, warunki reakcji obejmują 1 mililitr oleju sojowego, -0,4% wyjściowej wilgotności w oleju przed którymkolwiek dodawaniem, 50°C, 0,2% kwas cytrynowy zobojętniany 2,75M NaOH, 10U PLC, 15 ?l PI-PLC (0,45 mg całkowitego białka), 1 godzina całkowity czas reakcji. Figura 12 ilustruje tabelę podsumowującą dane z tego dwu-enzymowego systemu odśluzowywania według ujawnienia. [0536] W innym aspekcie, enzym PI-PLC według ujawnienia można stosować w tych samych warunkach, jak opisane dla PLC. Te obejmują rafinowanie chemiczne olejów roślinnych i odśluzowywanie wodne olejów roślinnych. PRZYKŁAD 4: FOSFOLIPAZY O ULEPSZONEJ EKSPRESJI OPORNOŚCI NA PROTEAZĘ I ZMIENIONEJ [0537] Wynalazek zapewnia sposób selekcjonowania wariantów fosfolipazy C (mutantów) mających ulepszoną ekspresję w glikozylującym gospodarzu i zmienioną oporność na wydzielane proteazy. Ulepszona ekspresja w glikozylującym gospodarzu. [0538] Potencjalne połączone asparaginami miejsca glikozylacji z konsensusową sekwencją aminokwasową, asparagina-dowolny aminokwas-seryna lub treonina (NXS/T w jednoliterowym kodzie aminokwasowym), usuwano za pomocą procedury ?knockout? przy użyciu sposobów mutagenezy, aby zmienić asparaginy lub serynę lub treoninę w motywie rozpoznającym glikozylacji na inne aminokwasy, tak, że sekwencja nie będzie dłużej kodować potencjalnego miejsca glikozylacji. Usuwanie miejsc glikozylacji wykonywano jak wskazano poniżej: pozycje aminokwasowe aminokwasu 63, aminokwasu 131 i aminokwasu 134 fosfolipazy C enzymu według wynalazku mające sekwencję aminokwasową jak podano w SEQ ID NO:2, np. kodowane przez SEQ ID NO:1. Ta eliminacja miejsc glikozylacji ulepszyła ekspresję tego wariantu, aktywnego enzymu fosfolipazy C (PLC, SEQ ID NO:2), gdy białko było heterologicznie eksprymowane w drożdżach Pichia pastors. Ta strategia zmniejszania lub eliminowania potencjalnych miejsc glikozylacji w enzymie PLC może poprawić ekspresję aktywnego PLC w dowolnym glikozylującym gospodarzu. Wynalazek zapewnia zatem enzymy fosfolipazy (i kodujące je kwasy nukleinowe), mające sekwencję dowolnej z przykładowych fosfolipaz według wynalazku ze zmienionym jednym lub więcej lub wszystkimi miejscami glikozylacji, jak omówiono powyżej. Zatem wynalazek zapewnia sposoby wytwarzania wariantu sekwencji kodujących fosfolipazę o podwyższonej ekspresji w komórce gospodarza, przy czym sposób obejmuje modyfikowanie sekwencji kodującej fosfolipazę według wynalazku tak, że jedno, kilka lub wszystkie motywy kodujące miejsce N- -174- glikozylacji są modyfikowane do motywu nieglikozylowanego. Wynalazek zapewnia również sekwencję kodującą fosfolipazę otrzymaną tym sposobem, i enzymy, które kodują. Zmieniona oporność na proteazę [0539] Wynalazek zapewnia sposoby wytwarzania wariantowej sekwencji kodującej fosfolipazę, kodującej fosfolipazę o podwyższonej oporności na proteazę, obejmujące modyfikowanie aminokwasu równorzędnego wobec pozycji 131 SEQ ID NO:175, dla jednej, kilku lub wszystkich poniższych reszt: Lizyna (K); Seryna (S); Glicyna (G); Arginina (R); Glutamina (Q); Alanina (A); Izoleucyna (I); Histydyna (H); Fenyloalanina (F); Treonina (T); Metionina (M) Leucyna (L), w tym warianty do SEQ ID NO:2 (i kwasu nukleinowego, który je koduje) mające te przykładowe modyfikacje. Wynalazek zapewnia również izolowane, syntetyczne lub rekombinowane fosfolipazy kodowane przez sekwencję wykonaną tym sposobem. Ujawnienie zapewnia również sposoby wytwarzania wariantowej sekwencji kodującej fosfolipazę, kodującej fosfolipazę o obniżonej oporności na proteazę, obejmujące modyfikowanie aminokwasu równorzędnego wobec pozycji 131 SEQ ID NO:175, dla jednej, kilku lub wszystkich poniższych reszt: Tryptofan (W); Glutaminian (E); Tyrozyna (Y), w tym warianty do SEQ ID NO:2 (i kwasu nukleinowego, który je koduje) mające te przykładowe modyfikacje. Wynalazek zapewnia również izolowane, syntetyczne lub rekombinowane fosfolipazy kodowane przez sekwencję wykonaną tym sposobem. [0540] Supernatant zawierający mieszaninę natywnych, wydzielanych proteaz Pichia pastoris mieszano i inkubowano z preparatami enzymów PLC typu dzikiego i mutanta PLC. Reakcje wygaszano, a rozkład wizualizowano za pomocą SDS-PAGE versus kontrola ujemna ? brak proteazy. Rozkład można również określić za pomocą pomiaru resztkowej aktywności PLC. Nowość stanowiły obserwacje, że niektóre mutacje usuwające glikozylację istotnie zmieniały wrażliwość eksprymowanej fosfolipazy na rozkład podczas fermentacji. Korzyścią ze sposobu jest bezpośrednia selekcja mutantów o podwyższonej lub obniżonej oporności na proteazy wydzielane przez organizm gospodarza podczas produkcji. [0541] Ten sposób według wynalazku może wykorzystywać mutagenezę ukierunkowaną (np. GSSM?) do zmian sekwencji aminokwasowej enzymu fosfolipazy C według wynalazku, np. jak pokazano poniżej - podsekwencja SEQ ID NO:2 (kodowana przez SEQ ID NO:1). Każdy z aminokwasów zakreślonych na czerwono (poniżej) został zmieniony z asparaginy (N w kodzie jednoliterowym) na Asparaginian (D), serynę (S) lub inny aminokwas jak opisano poniżej. Te aminokwasy są oznaczone jako aminokwas 63, aminokwas 131 i aminokwas 134 sekwencji poniżej, w której tryptofan (W) jest oznaczony jako aminokwas 1. Te mutacje wykonano w celu podwyższenia ekspresji aktywnego białka fosfolipazy C przez obniżenie glikozylacji eksprymowanego białka w systemie ekspresji Pichia pastoris. Te same mutacje mogą podwyższać ekspresję dowolnej aktywnej fosfolipazy C według wynalazku w dowolnym innym systemie ekspresji, który glikozyluje asparaginy (N-glikozylacja) według systemu NXS/T, gdzie N oznacza asparaginę, X oznacza dowolny aminokwas i S/T oznacza serynę lub treoninę. Zatem wynalazek zapewnia również sposób zmieniania wrażliwości eksprymowanej fosfolipazy C przez zmienianie aminokwasu w pozycji 131. -175- Aminokwasy 39-286 z SEQ ID NO:2: [0542] UWAGA: Aby obliczyć zmienione pozycje, należy liczyć pierwszy aminokwas (W) jako pozycja 1. [0543] Eksprymowane warianty fosfolipazy C inkubowano w obecności proteaz P. pastoris jak opisano poniżej i otrzymano poniższe wyniki: Poniższe aminokwasy w pozycji aminokwasowej 131 SEQ ID NO:2 podwyższały oporność eksprymowanej fosfolipazy C na rozkład przez proteazy P. pastoris: Lizyna (K); Seryna (S); Glicyna (G); Arginina (R); Glutamina (Q); Alanina (A); Izoleucyna (I); Histydyna (H); Fenyloalanina (F); Treonina (T); Metionina (M) Leucyna (L). Poniższe aminokwasy w pozycji aminokwasowej 131 SEQ ID NO:2 obniżały oporność eksprymowanej fosfolipazy C na rozkład przez proteazy P. pastoris: Tryptofan (W); Glutaminian (E); Tyrozyna (Y). Zatem wynalazek zapewnia wariant fosfolipazy mający dowolną jedną z, lub kilka lub wszystkie te modyfikacje, w zależności od tego, czy pożądane było, aby podwyższyć czy obniżyć oporność eksprymowanej fosfolipazy C na degradację przez proteazę. Wynalazek zapewnia wariant fosfolipaz mający dowolną jedną z, lub kilka lub wszystkie te modyfikacje w pozycjach równorzędnych do pozycji 131 z SEQ ID NO:2. To, która reszta jest równorzędna do pozycji 131 z SEQ ID NO:2, i czy dowolne określone reszta modyfikacje aminokwasowe podwyższają lub obniżają oporność enzymu na rozkład przez proteazę, może być rutynowo oznaczane i przewidywalnie ustalane za pomocą protokołów dobrze znanych ze stanu techniki, np. przykładowych oznaczeń stosowanych do oceny wrażliwości na proteazę (SEQ ID NO:2, kodowane przez SEQ ID NO:1) fosfolipazy C opisanej poniżej: Bufory: [0544] ? 1.0 M MES, pH 6.2 ? 0.7 M octan sodu (?NaAc?), pH 5.2 Prowokacja: [0545] o Stosować oddzielne 1,5 ml probówki do mikrowirówki o Do 25 ?l próbki enzymu PLC dodać 5 ?l NaAc lub 7 ?l buforu MES i wymieszać o Dodać 25 ?l supernatantu Pichia pastoris zawierającego proteazę i wymieszać -176- o Dodać 2 ?l 5% azydku sodowego i wymieszać o Umieścić probówki na pływającym stojaku, w zlewce ze wstępnie ogrzaną wodą, w cieplarce z nawadnianiem o Kontrole obejmują PLC + bufor + dH2O i Pichia SN + bufor + dH2O o Inkubować od 0 do 24 godzin, pobierając próbki w licznych punktach czasowych, jeśli jest to pożądane Wykrywanie: [0546] ? Wizualizować na SDS-PAGE przez mieszanie próbek 1:2 z buforem do próbek, zawierającym 5 mM EDTA, ogrzewać w 100 °C, 4 minuty, schłodzić, wirować, mieszać, załadować 5 ?l próbki na ścieżkę, wybarwiać Coomassie. ? Próbki i punkty czasowe można również brać bezpośrednio ze standardowego oznaczenia aktywności PLC. [0547] Wyniki: wykonano elektroforezę na żelach SDS-PAGE, a wyniki są zilustrowane na Figurze 17; która pokazuje wyniki doświadczeń trawienia in vitro, w których warianty fosfolipazy C inkubowano w surowych ekstraktach proteazy przez aż do 22 godz. w 37°C. Każdego z mutantów PLC nazwano według aminokwasu znalezionego w pozycji ?X? sekwencji ?DXD? (asparaginian w pozycji aminokwasowej 63-dowolny aminokwas w pozycji aminokwasowej 131-asparaginian w pozycji aminokwasowej 134). Żele wskazują na stabilność lub czułość eksprymowanego mutanta PLC białka po inkubacji z surową proteazą. Stabilny mutant wykazuje prążek PLC o podobnej intensywności wybarwiania w ??(kontrola, brak reakcji proteazy) i ?+? (reakcja z proteazą). Mutant o wyższej czułości na proteazę będzie prezentował zmniejszenie intensywności prążka białka PLC w ścieżce ?=? w porównaniu do ścieżki ?-?. PRZYKŁAD 5: SPOSÓB DLA STABILNIE WYSOKIEGO POZIOMU EKSPRESJI PLC [0548] Wynalazek zapewnia sposób fermentacji dla stabilnego, wysokiego poziomu ekspresji i wysokiej aktywności specyficznej enzymów fosfolipazy, np. PLC, w hodowlach drożdży, np. hodowlach Pichia pastoris. Enzymy wyprodukowane tym sposobem można stosować, np. w rafinowaniu oleju roślinnego takiego, jak soja, rzepak canola, słonecznik lub inne oleje. [0549] Wynalazek zapewnia sposób produkcji zawierający charakterystykę, która umożliwia produkcję aktywnej fosfolipazy, np. PLC, w hodowli komórek drożdży, np. Pichia pastoris, jako hodowli półciągłych na skalę g/l. Heterologiczną ekspresję aktywnego białka PLC w hodowlach mikroorganizmów okazjonalnie opisywano w literaturze, jedynie w skali mg/l. Sposób według niniejszego wynalazku jest oparty, m.in. na stwierdzeniu, że ekspresja białka PLC w hodowlach Pichia zaburza zdolność do pobierania MeOH, ale nie wpływa na żaden inny badany fizjologiczny parametr wzrostu. Kontrastowo do konwencjonalnej ekspresji heterologicznego białka w hodowlach Pichia, wymagana jest duża szybkość współ-zasilania (glukozy/lub glicerolu). Oprócz ulepszania charakterystyki produkcji enzymu, wyższe współ- -177- zasilanie eliminuje również ekspresję proteazy o ogólnej aktywności, która jest skorelowana z rozkładem PLC. Dodatkowo, słabą charakterystykę wykorzystywania MeOH można przezwyciężyć, tym samym ulepszając dodatkowo charakterystykę produkcji, przez wytwarzanie PLC w szczepie Pichia z fenotypem Mut+, bez uszczerbku dla wyzwań związanych ze skalowaniem, normalnie powiązanych z fenotypem Mut+ (i w konsekwencji, nie są stosowane na skalę przemysłową). Zatem ten sposób według wynalazku ulepsza produkcję aktywnego PLC o >50-krotnie (ze 100 U/ml przy użyciu konwencjonalnych sposobów do >5000 U/ml pełny bulion; > 5 g/l białko) w porównaniu do warunków, które są normalnie stosowane przy skali przemysłowej dla systemów Pichia. Dodatkowo, ponieważ PLC jest metalo-enzymem, wymagającym wiązania cynku do prawidłowego składania i aktywności, w jednym aspekcie wynalazek obejmuje suplementację cynku. Ta strategia suplementacji cynku w hodowlach według wynalazku czyni aktywność PLC niemal w pełni stabilną (< 5% utrata aktywności) w pełnym bulionie, np. w 4°C przez > 5 dni. To istotnie wspomaga sposób odzyskiwania, ponieważ 1) produkcja białka o niestabilnej aktywności ciągle się pogarsza podczas sposobu odzyskiwania, i 2) umożliwia to lepszą elastyczność obróbki, szczególnie na dużą skalę. Oznaczenie Aminopeptydazy Tryptofanylu na Mikropłytce [0550] Ujawnienie zapewnia oznaczenie aminopeptydazy tryptofanylu na mikropłytce, które opracowano do wyznaczania względnej aktywności aminopeptydazy tryptofanylu w próbkach z punktów czasowych fermentacji w Pichia. Przepustowość tego oznaczenia jest wystarczająca do pobierania próbek z licznych punktów czasowych, z licznych fermentacji. Materiały i Metody Bufor: [0551] ? 15 mM NaPO4, 2 mM MnCl2, pH 7,5, aq. Substrat: [0552] ? HTrp-AMC (Bachem, I1670) Roztwór substratu: [0553] ? Rozpuścić substrat do 10 mM w metanolu ? Dodać 100 ?l 10 mM substratu do 6 ml buforu Próbki: [0554] ? Punkty czasowe z fermentacji Pichia ? Wirowanie do usunięcia komórek. -178- Przygotowanie mikropłytki: [0555] ? Poporcjować 90 ?l roztworu substratu na studzienkę czarnej płytki 96-studzienkowej, dla każdego powtórzenia próbki, prób ślepych i referencyjnych ? Umieścić mikropłytkę na podstawie czytnika fluorescencyjnego do mikropłytek (np. SpectraMax, Molecular Dynamics) Dodawanie próbki i kinetyka reakcji: [0556] ? Nastawić fluorescencyjny czytnik do mikropłytek: o Wzbudz. 350 nm/Em. 460 nm; automatyczne odcinanie (455 nm); PMT średnie; 3 odczyty na studzienkę; autokalibrator ?on? o RT ? 0-30 minut przebieg w czasie; odczyt co 30 sekund o Zainicjować funkcję instrumentu mieszania płytek, z mieszaniem przez 5 sekund przed pierwszym odczytem ? Poporcjować próbki w formacie 96-studzienkowym i stosować pipetę wielokanałową do przenoszenia próbek po 10 ?l na studzienkę ? Ze zdjętą pokrywą, zastąpić mikropłytkę w czytniku do mikropłytek ? Rozpocząć odczytywanie [0557] W zależności od inherentnej aktywności nieznanych próbek, może być pożądane, aby różnicować rozcieńczenie próbki, czas trwania oznaczenia i kinetykę pobierania próbek, wszystkie zmienne, które można wyznaczyć przez rutynowe badanie przesiewowe. [0558] Substrat okazał się być bardzo stabilny w tych warunkach, a ślepa kontrola ujemna nie powinna wskazywać wzrostu absorbancji z czasem. Oznaczenie Proteazy Bodipy BSA na Mikropłytce [0559] Ujawnienie zapewnia oznaczenie proteazy Bodipy BSA na mikropłytce, które opracowano jako pomoc do wyznaczania ogólnej aktywności proteazy w próbkach z punktów czasowych fermentacji w Pichia. Przepustowość tego oznaczenia jest wystarczająca do pobierania próbek z licznych punktów czasowych, z licznych fermentacji. Materiały i Metody Substrat: [0560] ? DQ BSA green (Molecular Probes, D12050) Roztwór substratu: -179- [0561] ? Rozpuścić zawartość jednej fiolki substratu (1 mg) w 1 ml wody zawierającym 0,1% azydek sodowy Próbki: [0562] ? Punkty czasowe z fermentacji Pichia ? Wirowanie do usunięcia komórek. Kontrola dodatnia: [0563] ? 0,2 mg/mL subtylizyny (Sigma, P5380) w 50 mM NaPO4, pH 7,5 ? Seryjnie rozcieńczyć w wodzie Przygotowanie mikropłytek: [0564] ? Poporcjować 90 ?l roztworu substratu na studzienkę czarnej płytki 96-studzienkowej, dla każdego powtórzenia próbki, prób ślepych i referencyjnych Dodawanie próbki i reakcja: [0565] ? Poporcjować próbki w formacie 96-studzienkowym i stosować pipetę wielokanałową do przenoszenia próbek po 10 ?l na studzienkę ? Zdjąć osłonę mikropłytki, owinąć folią i umieścić w cieplarce z nawadnianiem w 37 °C, umożliwić inkubację przez 3-4 godziny lub przez noc Pomiar fluorescencji: [0566] ? Nastawić fluorescencyjny czytnik do mikropłytek (SpectraMax): o Wzbudz. 495 nm/Em. 525 nm; automatyczne odcinanie (515 nm); PMT niskie; 3 odczyty na studzienkę; autokalibrator ?on? o RT [0567] Bodipy BSA wybrano jako ogólny substrat proteazy. Brak hydrolizy Bodipy BSA nie wskazuje na nieobecność proteazy, ale wykazano, że koreluje z hydrolizą enzymu PLC i utratą aktywności PLC. Wykazano, że BSA można podstawić Bodipy albumina jaja lub kazeiną. [0568] W jednym aspekcie, użyteczne jest, aby charakteryzować aktywność proteazy dla przebiegu fermentacji w czasie, jako że aktywność może być czasowa i przejściowa. -180- [0569] Substrat okazał się być bardzo stabilny w tych warunkach, a ślepa kontrola ujemna nie powinna wskazywać wzrostu absorbancji w czasie. Pomiar aktywności PLC w pełnym bulionie hodowlanym lub supernatancie: [0570] Ujawnienie zapewnia oznaczenie pomiar aktywności PLC w pełnym bulionie hodowlanym lub supernatancie; jest to modyfikacja sposobu opisanego, np. przez Edward A. Dennis (1973) Kinetic dependence of phospholipase A2 activity on the detergent Triton X100. J. Lipid Res. 14:152-159, USP 24/NF 19. Pancrealipase-Assay for lipase activity. Str. 1256-1257. Oznaczenie pomiaru aktywności PLC według ujawnienia obejmuje: Roztwory: [0571] 100 mM Roztwór Siarczanu Cynku 100 mM Roztwór Chlorku Wapnia Roztwór Substratu (20 mM Fosfatydylocholina, 40 mM Triton X-100, 5 mM Chlorek Wapnia) Bufor do Rozcieńczeń (0,1% Triton X-100, 1 mM Siarczan Cynku, 1% Guma Arabska) Procedura Oznaczenia: [0572] - Przygotować rozcieńczenia próbek do oznaczania, przy użyciu buforu do rozcieńczenia (1,0% guma arabska, 1,0% Triton X-100, 1 mM siarczan cynku). Przygotować rozcieńczenia tuż przed oznaczeniem, przy użyciu lodowato zimnego buforu, i przechowywać w łaźni z lodem do momentu użycia. - Przenieść 20 ml roztworu substratu do szklanego naczynia z płaszczem o pojemności około 50 ml, którego zewnętrzna komora jest podłączona do sterowanej termostatem łaźni wodnej. Przykryć mieszaninę, i mieszać w sposób ciągły za pomocą mechanicznego urządzenia mieszającego. Z mieszaniną utrzymywaną w temperaturze 37 ? 0,1°C wstępnie miareczkować substrat 0,01 N KOH VS, z mikrobiurety wprowadzonej przez otwór w pokrywie, aby nastawić pH 7,3. Dodać 50 ?l rozcieńczenia enzymu, i następnie kontynuować automatycznie dodawanie 0,01 N KOH VS przez 6 minut, aby utrzymać pH 7. [0573] Dodatkowo, wykonać standardową elektroforezę żelową PAGE, analizę hybrydyzacyjną Western i Northern na hodowlach poddawanych fermentacji, jak również stosować standardowe techniki analiz wobec parametrów fermentacji on-line/off-line (poziomy biomasy, analiza gazu itd.) Generowanie szczepu Pichia o fenotypie Mut+ [0574] Wynalazek zapewnia komórki, układy komórkowe i sposoby do eksprymowania fosfolipazy C, w tym stosowanie szczepu Pichia o fenotypie Mut+. Sposób obejmuje -181- wprowadzanie heterologicznego kwasu nukleinowego kodującego PLC do szczepu Pichia. Komórki są następnie hodowane w warunkach, dzięki których PLC jest eksprymowane. Sposób może dodatkowo obejmować uzupełnianie warunków hodowli o cynk. [0575] W jednym aspekcie, te sposoby, komórki i układy komórkowe wykorzystują SEQ ID NO:2, która oznacza wymagający cynku metaloenzym. W jednym aspekcie, jest on wykorzystywany przy stężeniu 3 mole. Ma MW w przybliżeniu 28 kDa, pI w przybliżeniu 5,2, i ma szeroką tolerancję wobec substratu: PC > PE> PS >> PI. Nieprzetworzony enzym ma sekwencję sygnałową 24 aminokwasy, prosekwencję 13 aminokwasów, a ?dojrzały? enzym ma 245 reszt aminokwasowych. [0576] W jednym aspekcie, szczep Pichia Mut+ według wynalazku ma dwie kopie genów oksydazy alkoholowej (AOX), AOX1 i AOX2, na które wpływa transformacja (?Mut? oznacza ?Metanol Utilization ? zużywanie metanolu?), w następujący sposób: ? ? ? Mut+ ? Pojedyncze zdarzenie crossover, geny AOX1 i AOX2 nienaruszone ? Wzrost i ekspresja jedynie na metanolu. Współ-zasilanie możliwe MutS ? Podwójne zdarzenie crossover zakłóca gen AOX1 ? Wzrost i ekspresja ulepszona dzięki współ-zasilaniu Mut? Zdarzenie rekombinacyjne zakłóca geny AOX1 i 2 ? Niemożność metabolizowania metanolu, konieczne współ-zasilanie Podsumowując: Mut- < Mutsplc < Muts/Mut+plc < Mut+ [0577] Istnieją różnice co do fermentacji pomiędzy Mut+ i Muts, w tym: ? Optymalne Stężenie Do Indukcji Metanolu ? Szybkość Zużywania Tlenu ? Mut+ rośnie szybciej niżMuts na Metanolu, ze względu na zdolność do szybszego pobierania ? Łatwy Okres Przejściowy po Indukcji ? Mut+ nie stosuje się do ekspresji na dużą skalę ? Zdolność do napowietrzania/schładzania, czułość na MeOH [0578] Szlak wykorzystywania metanolu w Pichia pastoris jest dobrze znany ze stanu techniki. Oksydaza alkoholowa (AOX) katalizuje konwersję metanolu do formaldehydu; zatem jeśli AOX jest nadeksprymowane, powoduje ?kiszenie? komórki drożdży. -182- [0579] Przykładowy protokół fermentacji dla zastosowanej Pichia pastoris zawiera w jednym aspekcie ujawnienia: ? Hodowla Starterowa (butelka lub zbiornik) ? ? Fermentacja okresowa w bogatej pożywce, dla zwiększenia biomasy Hodowla Okresowa z Zasilaniem w Fermentorze ? Faza Okresowa (Glicerol) ? ? ? Biomasa wzrasta wraz ze zużywaniem początkowego źródła węgla. Faza Zasilania w Glukozę lub Glicerol ? Dodawanie zasilania uruchamiane przez zawartość D.O. lub zasilanie liniowe/wykładnicze ? Wzrost do wystarczającej biomasy, do celów indukcji i ekspresji (nieobecność etanolu, C-ograniczone) Indukcja Metanolem ? Dodawanie zasilania regulowane (D.O.%, MeOH sensor, RQ) lub ustawione z góry profile zasilania ? Współ-zasilanie glukozą lub glicerolem, zależnie od fenotypu i parametrów ekspresji ? Indukcja Mut+ przy 1-3 g/L MeOH ? Indukcja Muts przy 4-7 g/L MeOH [0580] Figura 18 ilustruje wyniki hodowli okresowej w fermentorze, jak omówiono powyżej, z zastosowaniem jedynie glicerolu. Aktywność proteazy pochodzi od endogennej proteazy w Pichia. Fermentacja okresowa może być prowadzona w bogatej pożywce, aby stymulować powstawanie biomasy. Jak odnotowano na Fig. 18, stopniowy wzrost aktywności proteazy, rozpoczynający się w około 69 godzinie odpowiada stopniowemu spadkowi aktywności PLC. Wyższa szybkość współ-zasilania glicerolem (glyc) zwiększa aktywną ekspresję PLC i obniża (eliminuje) produkcję proteazy, jak ilustruje poniższa tabela z zestawieniem danych: Szybkość współzasilania (ml/min) C-źródło (ml/min) Aktywność PLC Zużyty MeOH przed/po indukcji (U/ml sup) (L) 0,5 Glyc/Glyc 100 1,5 Glyc/Glyc 2 Glyc/Glyc Indukcja OD 250-300 Bodipy proteaza Końcowe OD 1 Tak 450 1100 1,7 Nie 680 1550 1,3 Nie 860 -183- 2,5 Glyc/Glyc 1550 1,4 Nie 900 3 Glyc/Glyc 1715 1,4 Nie 820 [0581] Te badania wykonano w 30-L fermentorach BB z DSD-PLC. Mierzono szybkość pobierania tlenu, objętościowo, OUR, lub ang. Vol. Oxygen Uptake Rate (?OUR?), jako ?ogólny wskaźnik zdrowia hodowli?, lub ?Biomarker?, dla dobrej ekspresji. Figura 19 ilustruje wyniki takiego badania, porównanie profilu OUR hodowli P. pastoris MutS 30 l wytwarzających DSD-PLC, przy użyciu 1700 U/ml, 1100 U/ml i 100 U/ml PLC, 30°C, współ-zasilania glicerolem, jak omówiono powyżej. [0582] Figura 20 ilustruje porównanie profilu zużycia metanolu w hodowlach P. pastoris MutS 30 l hodowle wytwarzających DSD-PLC, pH 6,2 (1100 U/ml i 100 U/ml PLC), lub heterologiczne białko, ze współ-zasilaniem glicerolem, jak omówiono powyżej. Było to zasilanie MeOH na zapotrzebowanie, a resztkowy poziom MeOH kontrolowano na poziomie 4 g/l. [0583] Dodatkowo, fenotyp Mut+ poprawia aktywną ekspresję PLC i podwyższa wychwytywanie MeOH, jak podsumowano w poniższe tabeli z danymi: Mut S + Szybkość współzasilania (ml/min) Indukcja OD 0,5 250-300 Aktywność Zużyty MeOH PLC (U/ml (l) sup) Proteaza Bodipy Końcowe OD 100 1 Tak 450 1,5 1100 1,7 Nie 680 2 1550 1,3 Nie 860 2,5 1550 1,4 Nie 900 3 1715 1,4 Nie 820 0,5 1001 5,6 tak 871 0,5 1200 7 Nie 908 1 1786 5,9 Nie 988 1 2010 6,8 Nie 930 1768 7,9 Nie 700 1,5 2669 10 Nie 701 1,5 2693 7,1 Nie 818 1,5 2597 8,1 Nie 804 2 2154 8,3 Nie 752 1 250-300 [0584] PLC zdaje się nie wpływać na charakterystykę fizjologicznego wzrostu tego fenotypu szczepu Mut+, który eksprymuje rekombinowany PLC SEQ ID NO:2, w liczbie kopii 6X, -184- dane zilustrowane na figurze 21, profil OUR jak podano na opisie figury. Jest to regulowane zapotrzebowaniem zasilanie w MeOH, przy czym nie ma szczątkowej glukozy lub MeOH w hodowlach Mut+. [0585] Dodatkowo, jakość wyprodukowanego białka PLC jest nieprzewidywalnie zmienna, np. ? lub ? 50% całkowitego białka PLC jest aktywne, jak zilustrowano przez przedstawienie wyników z SDS-PAGE, na figurze 22. Profil OUR (omówiono powyżej) ? graficzne podsumowanie danych wprowadzono przy górnej sekcji ilustracji SDS-PAGE. Kontrolę oznaczono JG= 0,5 ?l 1,6 mg ml-1. Nie stwierdzono korelacji z aktywnością proteazy lub aminopeptydazy. Istotna ilość aktywnej PLC lokalizowała się wewnątrzkomórkowo, jak zilustrowano na figurze 23 (pokazującej również protokół badania), gdzie >700 U/ml PLC wykrywano wewnątrzkomórkowo (na Fig. 23, PLC (SEQ ID NO:2) + alfa peptyd sygnałowy (z Saccharomyces) + glikozylacja). Zmiany morfologiczne były skorelowane z aktywnym stężeniem PLC, jak zilustrowano na figurze 24. Rząd wielkości zmian morfologicznych zależał od szczepu i źródła C. [0586] Podwyższony Zn nie podwyższył ekspresji w szczepie Pichia mającym liczbę kopii 2X Mut+ SEQ ID NO:2 z mutacją DSD, jak podsumowano w wykresie z danymi, poniżej (nadmiar ponad 1X dostarczany przez współ-zasilanie) (pierwszy, górny rząd oznacza kontrolę ? pusty wektor). Podwyższony Zn podwyższył stabilność przechowywania jako pełny bulion (podobny poziom aktywności po >100 godz. w 4°C) i ogólną solidność sposobu. Zn MeOH (L) Zasada (L) 70% (v/v) Glicerol (L) OD600 PLC (U/ml) 1X (2.2 mM) 7,1 2,3 9.6 765 0 0,2X 7,4 2,1 8.6 731 392 1X 7,1 2,8 9,0 776 2700 4X 6,1 2,2 10 780 2448 12X 6.4 2.3 9.8 776 2498 [0587] Figura 25 obrazowo zestawia dane prezentując status wydajności produkcji PLC po 95 godz. TFT (całkowity czas fermentacji) w Pichia. Pięć słupków po prawej stronie wykresu pokazuje wyniki dla ?szczepu Zeo? lub przystosowanie do zeocyny przy wytwarzaniu PLC w szczepie Pichia pastoris. Ten szczep oznacza oporny na antybiotyk, pozbawiony markera szczep eksprymujący jako gen heterologiczny PLC według ujawnienia (SEQ ID NO:2) w szczepie Pichia pastoris. Wykazano, że przez przystosowanie szczepu do zeocyny, antybiotyku, można otrzymać nowy stabilny szczep z wielce ulepszonym poziomem ekspresji dla przedmiotowego białka. [0588] Wyjściowy oporny na antybiotyk, pozbawiony markera szczep, szczep #1 (zawierający SEQ ID NO:2), hodowano w stadiach, w szeregu rozcieńczeń, za każdym razem z wzrastającym stężeniem zeocyny, która jest antybiotykiem. Na każdym z etapów, część hodowli z poprzedniego etapu rozcieńczano do gęstości optycznej 1,0 dla 600 nm (OD600) świeżą pożywką i dodawano zwiększającą się ilość zeocyny do nowej hodowli, na kolejne 24 godziny wzrostu. Na końcowym etapie stosowano stężenie zeocyny 200 ug/ml, i końcową -185- hodowlę przeszczepiano na płytkę MD/YPD, aby umożliwić wzrost poszczególnych kolonii. Stwierdzono, że kolonie z końcowego etapu hodowli wykazują dużą tolerancję na zeocynę, podczas gdy szczep macierzysty wykazuje bardzo małą tolerancję. Jedna z kolonii, szczep #2 (zawierający SEQ ID NO:2), wykazała dramatyczną poprawę (około 70% wzrost) ekspresji PLC w porównaniu do wyjściowego szczepu PLC, szczep #1. Wykazano również, że szczep #2 jest stabilny zarówno co do tolerancji wobec zeocyny, jak i ekspresji PLC po 40pokoleniowym pasażowaniu, co wskazuje, że nowy szczep nabył ?stałą? cechę wysokiej ekspresji PLC i tolerancji na zeocynę. [0589] Wysoki poziom aktywności PLC osiągnięto przy użyciu ?szczepu Zeo? (adaptacja Pichia do zeocyny) według wynalazku: 4100 u/ml otrzymywano w mini-zbiornikach. Ten wynik pochodzi ze szczepu Pichia zawierającego 6x DSD SEQ ID NO:2. Pokrótce, ten szczep eksprymujący SEQ ID NO:2 ?przystosowywano? przez hodowanie go w szeregu etapów, każdy z wzrastającym stężeniem zeocyny. Widocznie, ten proces adaptacji wymusił pewne zmiany (na poziomie molekularnym lub genetycznym) w szczepach/konstrukcie i skutkowało to istotną poprawą poziomu aktywności PLC. Przykładowe wyniki to: ? Zbiorniki 1, 2 i 4 (każdy reprezentujący różne kolonie) wszystkie osiągały lepsze wyniki niż wyjściowy wstępnie adaptowany szczep eksprymujący SEQ ID NO:2, przy czym zbiornik 1 i 4 doszły do poziomu 4100 u/ml, a zbiornik 2 do poziomu 3500 u/ml. ? Zbiornik 1 i 4 doszły do poziomu ponad 3000 u/ml tak wcześnie, jak w 75 godz., reprezentując o wiele szybszą akumulację aktywności w porównaniu do wyjściowego, wstępnie przystosowywanego szczepu eksprymującego SEQ ID NO:2 (który jest normalnie znacznie poniżej 2000 u/ml w danym czasie). [0590] Szczegóły projektu i wyników doświadczeń to: Uzasadnienie przystosowania do zeocyny: [0591] Wcześniejsze etapy prac dotyczących ekspresji PLC prowadzono w wektorze Pichia pPICZa, który zawiera marker oporności na zeocynę. Zeocyna była zatem stosowana do selekcji transformacji. Później, zamieniono konstrukt na wersję pozbawioną AMR, do opracowywania komercyjnych kandydatów produktu. Podczas wykonywania fermentacji w mini-zbiorniku, obserwowano istotny spadek poziomu aktywności PLC otrzymanej przy użyciu konstruktów bez AMR: aktywność supernatantu osiągnęła 4000 u/ml w konstruktach pPICZa- DSD, podczas gdy osiągnięto zaledwie ok. 2000 u/ml w 2x DSD. Obserwowano również istotne fizjologiczne różnice, np. niższe tempo zużycia metanolu i znacznie nasiloną lizę komórek, dla konstruktów bez AMR, szczególnie przy testowaniu konstruktów o wyższej liczbie kopii (5x, 6x) przy użyciu tych samych protokołów fermentacji. [0592] Zważywszy, że jedną widoczną różnicą pomiędzy konstruktem pPIZa i konstruktem bez AMR, jest stosowanie zeocyny w transformacji, zadano pytanie o to, co przechodzą komórki przy selekcji zeocyną. Ujawnienie zapewnia hodowanie konstruktu bez AMR w obecności zeocyny - komórki następnie przechodzą pewne zmiany, korzystne dla ekspresji PLC. -186- Doświadczenia przystosowania do zeocyny na 2x DSD: [0593] Doświadczenie stosowano po raz pierwszy z 2x DSD (jako że była to cząsteczka do transferu w danym czasie). Badanie rozpoczęto od stężenia zeocyny 1 ug/ml (?zeo 1?) i hodowano kulturę przez ~24 godz. Od tego punktu podwyższano stopniowo stężenie zeocyny do zeo 5, zeo 10, zeo 15, zeo 20, zeo 40, zeo 60, zeo 80, zeo 100 i na końcu do zeo 200 (zeo 100 jest normalnie stosowane do selekcji transformacji). Na każdym etapie stosowano świeżą pożywkę i wykorzystywano poprzedni etap hodowli do zaszczepienia nowego etapu hodowli, z OD 1,0 i hodowano przez ~24 godz. Hodowle z każdego etapu przeszczepiano również na płytki YPD dla zachowania i do otrzymania poszczególnych kolonii. Wyniki fermentacji w mini-zbiornikach dla kolonii przystosowanych do zeo: [0594] Aby testować wyniki przystosowania do zeocyny, wybrano tuzin kolonii z hodowli zeo 200 i zeo 100 (które przeszczepiano na płytki YPD) i badano przesiewowo za pomocą mini-zbiorników. Wyniki zebrano na ilustracji 6. Zdołano znaleźć kilka kolonii, które istotnie przewyższały wyjściowy konstrukt (szczep Pichia zawierający SEQ ID NO:2). Spośród nich, kolonia #5 z hodowli zeo 200 wykazywała około 50% poprawą poziomu aktywności PLC. Obserwacje dotyczące badania przesiewowego: ? Nie zaobserwowano wyraźnych różnic w profilach wzrostu pomiędzy hodowlami przystosowanymi do zeo i wyjściowym szczepem eksprymującym SEQ ID NO:2. ? Chociaż nie badano szczegółowo stabilności przystosowanych hodowli, przeszczepiano je kilka razy na płytkach YPD i/lub MD bez obecności zeocyny. Wszystkie fermentacje wykonywano bez obecności zeocyny. ? Były widoczne wariacje pomiędzy koloniami, zarówno co do wzrostu, jak i ekspresji PLC. ? Pewne problemy techniczne z fermentacją mogły być częściowo odpowiedzialne za wariacje. Doświadczenia przystosowania do zeocyny na 6x DSD: [0595] Zachęceni wynikami z przystosowania do zeo 2x DSD, następnie wykonaliśmy te same doświadczenie na 6x DSD (które jak ustalono w danym czasie przewyższa 2x DSD). Badanie rozpoczęto od stężenia zeocyny 5 ug/ml (?zeo 5?) i hodowano kulturę przez ~24 godz. Od tego punktu podwyższano stopniowo stężenie zeocyny do zeo 15, zeo 30, zeo 50, zeo 100 i na końcu do zeo 200. Podobnie jak w przypadku 2x DSD, na każdym etapie stosowano świeżą pożywkę i wykorzystywano poprzedni etap hodowli do zaszczepienia nowego etapu hodowli, z OD 1,0 i hodowano przez ~24 godz. Hodowle z każdego etapu przeszczepiano również na płytki YPD dla zachowania i do otrzymania poszczególnych kolonii. Wyniki w mini-zbiornikach dla kolonii przystosowanych do zeo dla 6x DSD: -187- [0596] Wybrano sześć kolonii z hodowli zeo 200 (którą przeszczepiano na płytkę MD) i testowano wraz z wyjściowym szczepem eksprymującym SEQ ID NO:2 w mini-zbiornikach. Kluczowe obserwacje są jak poniżej: ? wszystkie trzy kolonie (zbiorniki 1, 2 i 4) osiągały lepsze wyniki niż wyjściowy szczep eksprymujący SEQ ID NO:2, przy czym zbiornik 1 i 4 doszły do poziomu 4100 u/ml, a zbiornik 2 do poziomu 3500 u/ml. ? zbiorniki 1 i 4 doszły do poziomu ponad 3000 u/ml tak wcześnie, jak w 75 godz., reprezentując o wiele szybszą akumulację aktywności w porównywaniu do wyjściowego szczepu eksprymującego SEQ ID NO:2 (który jest normalnie znacznie poniżej 2000 u/ml w danym czasie). ? również poziom białka PLC zdawał się być wyższy w zbiornikach 1, 2 i 4 w porównywaniu do analizy z 3000 u/ml w zbiorniku o pojemności 10 l (patrz ilustracja 4). Nie jest zatem jasne, czy pozorna aktywność specyficzna jest wyższa w zbiornikach 1, 2 i 4., tj. czy wyprodukowana PLC jest różna niż ta wyjściowa ze szczepu eksprymującego SEQ ID NO:2. ? Kontrola, zbiornik 7 i 8, nie doszła tym razem do poziomu 3000 u/ml. Nie wiadomo, czy zbiorniki 1, 2 i 4 byłyby w stanie osiągnąć jeszcze wyższy poziom. Należy zauważyć, że procentowy wzrost (35%, 4100 u/ml vs 3000 u/ml) jest niższy niż dla przystosowywanej hodowli 2x. ? Podsumowanie badań przesiewowych ekspresji na koloniach adaptowanych do zeocyny 6x DSD znajduje się na figurze 26. Najwyższy obserwowany poziom aktywności dla wyjściowego szczepu wynosił -3000 u/ml (mini-zbiornik o pojemności 10 l); poziom osiągnięty dla przystosowanego do zeocyny 6x DSD wynosił 4100 u/ml (~35 % wzrost). Figura 27 ilustruje dane, pokazujące że poziom białka PLC był wyższy w zbiornikach 1, 2 i 4 w porównaniu do analizy 3000 u/ml w zbiorniku o pojemności 10 l (przy warunkach dla danego zbiornika), jak omówiono powyżej (nanoszenie na żel wynosiło 1,0 ul 5X rozcieńczonego bulionu, 0,2 ul pełnego bulionu). Figura 28 pokazuje porównanie wzrostu kolonii przystosowanych do zeo vs kontrola. Przystosowane do zeocyny kolonie 6x DSD mają podobny profil wzrostu w porównaniu do wyjściowego szczepu eksprymującego SEQ ID NO:2 (6x DSD). [0597] Qp wydzielanego białka w hodowlach tlenowych drożdży z ograniczeniem C [źródła węgla] wynosi na ogół 0,5-2,5 mg/g.godz.-1 przy ? = 0,10 godz.-1. W oparciu o zawartość białka 400 mg/g DW obciążenie metaboliczne < 10% całkowitej szybkości produkcji białka. Poziom mRNA PLC pozostaje wysoki przez całą fermentację i nie koreluje z ekspresją. W oparciu o 5 g/l (150 g) białka PLC, mniej niż 0,1 mol C/godz. całkowitego 5 mol C/h (~2% całkowitego zużytego C) przechodzi do węgla PLC i ~ 25% przechodzi do biomasy. Aktywność PLC wydaje się nie wpływać na charakterystykę ogólną wzrostu fizjologicznego dla tych warunków produkcji (za wyjątkiem oddziaływania na zużywanie MeOH). [0598] Podsumowując, wynalazek zapewnia oporne na zeocynę układy komórek drożdży takie, jak komórki drożdży, linie komórkowe i/lub poszczególne komórki, do eksprymowania -188- heterologicznego białka (np. enzymu takiego, jak PLC) otrzymanego w sposobie obejmującym etapy zapewniania komórki Pichia sp. (np. P. pastoris) zawierającej heterologiczny kwas nukleinowy (np. wektor zawierający sekwencję kodującą enzym; ORF funkcjonalnie połączony z promotorem) zdolny do eksprymowania heterologicznego białka; hodowanie komórek w warunkach zawierających zeocynę w wyjściowym stężeniu (stężenie na tyle niskie, że niektóre komórki przeżywają, ale na tyle wysokie, żeby prowadzić selekcję komórek opornych na antybiotyk); selekcjonowanie komórek opornych na wyjściowe stężenie zeocyny, i ponowne hodowanie w warunkach zawierających wyższe stężenie zeocyny; selekcjonowanie komórek opornych na wyższe stężenie zeocyny. Wynalazek zapewnia również komórki drożdży, linie komórkowe i/lub poszczególne komórki otrzymane tym sposobem. Rutynowe badania przesiewowe mogą określić które wyjściowe stężenie antybiotyku zastosować, jak wiele należy wykonać rund, lub ile jest pożądane, i jak szybko zwiększać stężenia antybiotyku pomiędzy rundami selekcji. PRZYKŁAD 6: TERMOSTABILNA PLC [0599] Ujawnienie zapewnia termostabilne enzymy fosfolipazy. Zademonstrowano termostabilność dla przykładowego enzymu mającego sekwencję jak podano w SEQ ID NO:2. Termostabilność porównywalnych fosfolipidów według ujawnienia wykazano przy użyciu SEQ ID NO:2. Aktywność SEQ ID NO:2 testowano w dwóch różnych systemach: wodnym i w oleju. W systemie wodnym, stosowano surogat substratu (p-nppc) do pomiarów aktywności; enzym zaczął tracić aktywność w 86°C. Jednakże, dla oznaczenia w oleju enzym wykazywał dobrą aktywność w hydrolizowaniu substratów PC i PE obecnych w oleju sojowym w 85°C. Sprawdzano Tm tego samego enzymu i stwierdzono, że wynosiła ona 86°C przy 15mg/ml, i była nieodwracalna. [0600] Figura 29 ilustruje wyniki w doświadczeniu z ogrzewaniem do 85°C, z 10U SEQ ID NO:2, z warunkami wskazanymi na figurze. Figura 30 ilustruje dane NMR podsumowujące to doświadczenie ogrzewania. Figury 31, 32 i 33 ilustrują dane podsumowujące termostabilność SEQ ID NO:2 przy użyciu p-NPPC, w warunkach pokazanych na figurze. Figura 34 ilustruje dane z analizy DSC wykazując termostabilność SEQ ID NO:2, z enzymem przy stężeniu 15 mg/ml i Tm w 86°C. LISTA SEKWENCJI [0601] <110> DIVERSA CORPORATION GRAMATIKOVA, Svetlana HAZLEWOOD, Geoff BARTON,Nelson LAM, David <120> FOSFOLIPAZY, KODUJĄCE JE KWASY NUKLEINOWE I SPOSOBY ICH WYTWARZANIA I STOSOWANIA <130> 56446-20042.49 <140> Brak Przypisania <141> Równocześnie z Niniejszym -189- <150> 10/796,907 <151> 2004-03-08 <150> 10/421,654 <151> 2003-04-21 <150> 60/374,313 <151> 2002-04-19 <160> 174 <170> FastSEQ for Windows Version 4.0 <210> 1 <211> 849 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 1 <210> 2 <211> 282 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(24) <223> Otrzymana z próbki środowiskowej. <400> 2 -190- <210> 3 <211> 852 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 3 -191- <210> 4 <211> 283 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(24) <223> Otrzymana z próbki środowiskowej. <400> 4 <210> 5 <211> 843 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. -192- <400> 5 <210> 6 <211> 280 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(24) <223> Otrzymana z próbki środowiskowej. <400> 6 -193- <210> 7 <211> 963 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 7 -194- <210> 8 <211> 320 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(29) <223> Otrzymana z próbki środowiskowej. <400> 8 <210> 9 <211> 999 <212> DNA <213> Nieznana -195- <220> <223> Otrzymana z próbki środowiskowej. <400> 9 <210> 10 <211> 332 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(20) <223> Otrzymana z próbki środowiskowej. <400> 10 -196- <210> 11 <211> 1041 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 11 <210> 12 <211> 346 <212> PRT <213> Nieznana -197- <220> <223> Otrzymana z próbki środowiskowej. <400> 12 <210> 13 <211> 1038 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 13 -198- <210> 14 <211> 345 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 14 -199- <210> 15 <211> 1344 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 15 -200- <210> 16 <211> 447 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 16 -201- <210> 17 <211> 1137 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 17 -202- <210> 18 <211> 378 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 18 <210> 19 <211> 1248 -203- <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 19 <210> 20 <211> 415 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(19) <223> Otrzymana z próbki środowiskowej. <400> 20 -204- <210> 21 <211> 1716 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 21 -205- <210> 22 <211> 571 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(28) <223> Otrzymana z próbki środowiskowej. <400> 22 -206- -207- <210> 23 <211> 1473 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 23 <210> 24 <211> 490 <212> PRT <213> Nieznana -208- <220> <223> Otrzymana z próbki środowiskowej. <400> 24 <210> 25 -209- <211> 1098 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 25 <210> 26 <211> 365 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 26 -210- <210> 27 <211> 1287 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 27 -211- <210> 28 <211> 428 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 28 -212- <210> 29 <211> 753 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 29 -213- <210> 30 <211> 250 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 30 <210> 31 <211> 1422 <212> DNA -214- <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 31 <210> 32 <211> 473 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(20) <223> Otrzymana z próbki środowiskowej. <400> 32 -215- <210> 33 <211> 792 <212> DNA <213> Nieznana -216- <220> <223> Otrzymana z próbki środowiskowej. <400> 33 <210> 34 <211> 263 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 34 -217- <210> 35 <211> 1389 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 35 -218- <210> 36 <211> 462 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 36 -219- <210> 37 <211> 1329 <212> DNA <213> Nieznana <220> -220- <223> Otrzymana z próbki środowiskowej. <400> 37 <210> 38 <211> 443 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <223> Otrzymana z próbki środowiskowej. <400> 38 -221- <210> 39 <211> 1335 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 39 -222- <210> 40 <211> 444 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 40 -223- <210> 41 <211> 1419 <212> DNA <213> Nieznana <220> -224- <223> Otrzymana z próbki środowiskowej. <400> 41 <210> 42 <211> 472 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 42 -225- <210> 43 <211> 1287 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. -226- <400> 43 <210> 44 <211> 428 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 44 -227- <210> 45 <211> 1038 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. -228- <400> 45 <210> 46 <211> 345 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 46 -229- <210> 47 <211> 1476 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 47 -230- <210> 48 <211> 491 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 48 -231- <210> 49 <211> 1257 <212> DNA -232- <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 49 <210> 50 <211> 418 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <223> Otrzymana z próbki środowiskowej. <400> 50 -233- <210> 51 <211> 1482 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 51 -234- <210> 52 <211> 493 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 52 -235- <210> 53 <211> 1491 <212> DNA -236- <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 53 <210> 54 <211> 496 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 54 -237- <210> 55 <211> 1041 -238- <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 55 <210> 56 <211> 346 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 56 -239- <210> 57 <211> 1413 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 57 -240- <210> 58 <211> 470 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 58 -241- <210> 59 <211> 1038 <212> DNA -242- <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 59 <210> 60 <211> 345 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 60 -243- <210> 61 <211> 1257 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 61 <210> 62 <211> 418 <212> PRT <213> Nieznana -244- <220> <221> SYGNAŁOWA <222> (1)...(21) <223> Otrzymana z próbki środowiskowej. <400> 62 <210> 63 <211> 1242 -245- <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 63 <210> 64 <211> 413 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(18) <223> Otrzymana z próbki środowiskowej. <400> 64 -246- <210> 65 <211> 1164 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 65 -247- <210> 66 <211> 387 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 66 -248- <210> 67 <211> 1419 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 67 -249- <210> 68 <211> 472 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 68 -250- <210> 69 <211> 1038 <212> DNA -251- <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 69 <210> 70 <211> 345 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 70 Met Thr Thr Gln Phe Arg Asn Leu Ile Phe Glu Gly Gly Gly Val Lys -252- <210> 71 <211> 3264 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 71 -253- <210> 72 <211> 1088 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. -254- <400> 72 -255- -256- <210> 73 <211> 753 <212> DNA <213> Nieznana <220> -257- <223> Otrzymana z próbki środowiskowej. <400> 73 <210> 74 <211> 250 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 74 <210> 75 -258- <211> 1335 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 75 <210> 76 <211> 444 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 76 -259- <210> 77 <211> 1026 <212> DNA <213> Nieznana <220> -260- <223> Otrzymana z próbki środowiskowej. <400> 77 <210> 78 <211> 341 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 78 -261- <210> 79 <211> 1701 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 79 -262- <210> 80 <211> 566 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <223> Otrzymana z próbki środowiskowej. <400> 80 -263- -264- <210> 81 <211> 1422 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 81 -265- <210> 82 <211> 473 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(25) <223> Otrzymana z próbki środowiskowej. <400> 82 -266- <210> 83 <211> 1290 <212> DNA <213> Nieznana -267- <220> <223> Otrzymana z próbki środowiskowej. <400> 83 <210> 84 <211> 429 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(22) <223> Otrzymana z próbki środowiskowej. <400> 84 -268- <210> 85 <211> 1038 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 85 -269- <210> 86 <211> 345 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 86 -270- <210> 87 <211> 870 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 87 <210> 88 <211> 289 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 88 -271- <210> 89 <211> 1422 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 89 -272- <210> 90 <211> 473 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(25) <223> Otrzymana z próbki środowiskowej. <400> 90 -273- <210> 91 <211> 1035 <212> DNA <213> Nieznana <220> -274- <223> Otrzymana z próbki środowiskowej. <400> 91 <210> 92 <211> 344 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 92 -275- <210> 93 <211> 963 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 93 <210> 94 <211> 320 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(29) <223> Otrzymana z próbki środowiskowej. -276- <400> 94 <210> 95 <211> 1038 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 95 -277- <210> 96 <211> 345 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 96 -278- <210> 97 <211> 1422 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 97 -279- <210> 98 <211> 473 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(25) <223> Otrzymana z próbki środowiskowej. <400> 98 -280- <210> 99 <211> 1053 <212> DNA <213> Nieznana -281- <220> <223> Otrzymana z próbki środowiskowej. <400> 99 <210> 100 <211> 350 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 100 -282- <210> 101 <211> 996 <212> DNA <213> Bakterie <400> 101 -283- <210> 102 <211> 331 <212> PRT <213> Bakterie <220> <221> SYGNAŁOWA <222> (1)...(39) <400> 102 -284- <210> 103 <211> 2205 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 103 <210> 104 <211> 734 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 104 -285- -286- -287- <210> 105 <211> 756 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej. <400> 105 <210> 106 <211> 251 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(30) <223> Otrzymana z próbki środowiskowej. <400> 106 -288- <210> 107 <211> 990 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 107 <210> 108 -289- <211> 329 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (56)...(195) <223> Specyficzna dla fosfatydyloinozytolu fosfolipaza C, domena X <400> 108 <210> 109 -290- <211> 990 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 109 <210> 110 <211> 329 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <221> DOMENA <222> (56)...(195) <223> Otrzymana z próbki środowiskowej <400> 110 -291- <210> 111 <211> 828 <212> DNA <213> Bakterie <400> 111 -292- <210> 112 <211> 275 <212> PRT <213> Bakterie <220> <221> SYGNAŁOWA <222> (1)...(16) <221> DOMENA <222> (34)...(168) <223> Specyficzna dla fosfatydyloinozytolu fosfolipaza C, domena X <400> 112 <210> 113 <211> 981 <212> DNA -293- <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 113 <210> 114 <211> 326 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (56)...(195) <223> Specyficzna dla fosfatydyloinozytolu fosfolipaza C, domena X <400> 114 -294- <210> 115 <211> 987 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 115 <210> 116 <211> 328 -295- <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (56)...(195) <223> Specyficzna dla fosfatydyloinozytolu fosfolipaza C, domena X <400> 116 <210> 117 <211> 987 -296- <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 117 <210> 118 <211> 328 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (56)...(195) <223> Specyficzna dla fosfatydyloinozytolu fosfolipaza C, domena X <400> 118 -297- <210> 119 <211> 987 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 119 -298- <210> 120 <211> 328 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (56)...(195) <223> Specyficzna dla fosfatydyloinozytolu fosfolipaza C, domena X <400> 120 -299- <210> 121 <211> 990 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 121 <210> 122 -300- <211> 329 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(23) <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (56)...(195) <223> Specyficzna dla fosfatydyloinozytolu fosfolipaza C, domena X <400> 122 <210> 123 -301- <211> 849 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 123 <210> 124 <211> 282 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(24) <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (1)...(281) <223> Zależna od cynku fosfolipaza C <400> 124 -302- <210> 125 <211> 1710 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 125 -303- <210> 126 <211> 569 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 126 -304- <210> 127 <211> 1038 <212> DNA <213> Nieznana <220> -305- <223> Otrzymana z próbki środowiskowej <400> 127 <210> 128 <211> 345 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (8)...(195) <223> Fosfolipaza podobna do patatyny <400> 128 -306- <210> 129 <211> 1434 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 129 -307- <210> 130 <211> 477 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <221> SYGNAŁOWA <222> (1)...(27) <221> DOMENA <222> (1)...(307) <223> Zależna od cynku fosfolipaza C <400> 130 -308- <210> 131 <211> 927 <212> DNA -309- <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 131 <210> 132 <211> 308 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (11)...(194) <223> Fosfolipaza podobna do patatyny <400> 132 -310- <210> 133 <211> 1053 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 133 -311- <210> 134 <211> 350 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (8)...(195) <223> Fosfolipaza podobna do patatyny <400> 134 -312- <210> 135 <211> 1710 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 135 -313- <210> 136 <211> 569 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 136 -314- -315- <210> 137 <211> 1038 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 137 <210> 138 -316- <211> 345 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <221> DOMENA <222> (8)...(195) <223> Fosfolipaza podobna do patatyny <400> 138 <210> 139 <211> 1692 -317- <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 139 <210> 140 <211> 563 <212> PRT <213> Nieznana <220> <221> SYGNAŁOWA <222> (1)...(20) <223> Otrzymana z próbki środowiskowej <400> 140 -318- -319- <210> 141 <211> 471 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 141 -320- <210> 142 <211> 157 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <220> <221> DOMENA <222> (14)...(157) <223> hydrolaza podobna do dehydrogenazy halokwasu <400> 142 -321- <210> 143 <211> 603 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 143 -322- <210> 144 <211> 200 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 144 -323- <210> 145 <211> 1197 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej -324- <210> 146 <211> 398 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 146 -325- <210> 147 <211> 1104 <212> DNA <213> Nieznana <220> -326- <223> Otrzymana z próbki środowiskowej <400> 147 <210> 148 <211> 367 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 148 -327- -328- <210> 149 <211> 975 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 149 <210> 150 <211> 324 -329- <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 150 -330- <210> 151 <211> 1341 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 151 -331- <210> 152 <211> 446 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 152 -332- <210> 153 <211> 384 -333- <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 153 <210> 154 <211> 127 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 154 -334- <210> 155 <211> 1263 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 155 <210> 156 <211> 420 -335- <212> 'PRT' <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <220> <221> SYGNAŁOWA <222> (1)...(36) <220> <221> DOMENA <222> (149)...(406) <223> Lipaza/Acylohydrolaza podobna do GDSL <400> 156 -336- -337- <210> 157 <211> 1329 <212> DNA <213> Nieznana <220> -338- <223> otrzymana z próbki środowiskowej <400> 157 <210> 158 <211> 442 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 158 -339- -340- <210> 159 <211> 1428 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 159 -341- <210> 160 <211> 475 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 160 -342- -343- -344- <210> 161 <211> 1740 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 161 -345- <210> 162 <211> 579 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <220> <221> SYGNAŁOWA <222> (1)...(24) <400> 162 -346- -347- <210> 163 <211> 1104 -348- <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 163 <210> 164 <211> 367 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <220> <221> DOMENA <222> (174)...(296) -349- <223> Lipaza (klasa 3) <400> 164 -350- <210> 165 <211> 927 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 165 -351- <210> 166 <211> 308 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <220> <221> DOMENA <222> (7)...(191) <223> Fosfolipaza podobna do patatyny <400> 166 -352- -353- <210> 167 <211> 522 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 167 -354- <210> 168 <211> 173 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <220> <221> SYGNAŁOWA <222> (1)...(30) <220> <221> DOMENA <222> (48)...(167) <223> nadrodzina PAP2 <400> 168 -355- <210> 169 <211> 579 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 169 -356- <210> 170 <211> 193 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <220> <221> DOMENA <222> (3)...(187) <223> hydrolaza podobna do dehydrogenazy halokwasu <400> 170 -357- <210> 171 <211> 834 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 171 -358- <210> 172 <211> 277 <212> PRT <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 172 -359- <210> 173 <211> 642 <212> DNA <213> Nieznana <220> <223> Otrzymana z próbki środowiskowej <400> 173 <210> 174 <211> 213 <212> PRT <213> Nieznana -360- <220> <223> Otrzymana z próbki środowiskowej <220> <221> DOMENA <222> (4)...(195) <223> hydrolaza podobna do dehydrogenazy halokwasu <400> 174 -361- Zastrzeżenia patentowe 1. Wyizolowany, syntetyczny lub rekombinowany kwas nukleinowy kodujący polipeptyd mający aktywność fosfolipazy zawierający (a) kwas nukleinowy mający 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do sekwencji kwasu nukleinowego kodującej sekwencję aminokwasową WSAEDKHNEGINSHLWIVNRAIDIMSRNTTIVNPNETALLNEWRADLENGIYS ADYENPYYDDSTYAS HFYDPDTGTTYIPFAKHAKETGAKYFNLAGQAYQNQDMQQAFFYLGLSLHY LGDVNQPMHAASFTD LSYPMGFHSKYENFVDTIKNNYIVSDSNGYWNWKGANPEDWIEGAAVAAKQ DYPGVVNDTTKDWF VKAAVSQEYADKWRAEVTPVTGKRLMEAQRVTAGYIHLWFDTYVNR, przy czym aminokwasem pozycji 63 jest D (Kwas asparaginowy), aminokwasem pozycji 131 jest S (Seryna) i aminokwasem pozycji 134 jest D (Kwas asparaginowy) i przy czym pierwszy aminokwas W (tryptofan) liczony jest jako pozycja 1. (b) kwas nukleinowy z (a), dodatkowo zawierający heterologiczną sekwencję kwasu nukleinowego lub peptyd sygnałowy, (c) kwas nukleinowy z (b), przy czym sekwencja heterologiczna kwasu nukleinowego zawiera lub składa się z sekwencji kwasu nukleinowego kodującej: (i) heterologiczną sekwencję sygnałową (liderową), heterologiczną sekwencję sygnałową (liderową) fosfolipazy lub heterologiczną sekwencję sygnałową (liderową) niefosfolipazy, lub (ii) domenę katalityczną, sekwencję łącznikową, miejsce rozpoznawania rozszczepienia proteazy, sekwencję enzymu niefosfolipazy lub sekwencję enzymu fosfolipazy, lub (d) kwas nukleinowy zawierający sekwencję całkowicie (w pełni) komplementarną z sekwencją kwasu nukleinowego z dowolnego z (a) do (c). 2. Wyizolowany, syntetyczny lub rekombinowany kwas nukleinowy kodujący polipeptyd mający aktywność fosfolipazy zawierający (a) kwas nukleinowy mający 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do sekwencji kwasu nukleinowego kodującej sekwencję aminokwasową WSAEDKHNEGINSHLWIVNRAIDIMSRNTTIVNPNETALLNEWRADLENGIYS ADYENPYYDDSTYAS HFYDPDTGTTYIPFAKHAKETGAKYFNLAGQAYQNQDMQQAFFYLGLSLHY LGDVNQPMHAASFTD LSYPMGFHSKYENFVDTIKNNYIVSDSNGYWNWKGANPEDWIEGAAVAAKQ DYPGVVNDTTKDWF VKAAVSQEYADKWRAEVTPVTGKRLMEAQRVTAGYIHLWFDTYVNR, przy -362- czym aminokwasem pozycji 63 jest D (Kwas asparaginowy) i aminokwasem pozycji 134 jest D (Kwas asparaginowy) i przy czym (i) aminokwas pozycji 131 jest zmodyfikowany do jednej z następujących reszt: Lizyna (K); Glicyna (G); Arginina (R); Glutamina (Q); Alanina (A); Izoleucyna (I); Histydyna (H); Fenyloalanina (F); Treonina (T); Metionina (M) Leucyna (L), przy czym wariantowa fosfolipaza ma zwiększoną oporność na proteazę, lub (ii) aminokwas pozycji 131 jest zmodyfikowany do jednej z następujących reszt: Tryptofan (W); Glutaminian (E); Tyrozyna (Y), przy czym wariantowa fosfolipaza ma zmniejszoną oporność na proteazę i przy czym pierwszy aminokwas W (tryptofan) liczony jest jako pozycja 1, (b) kwas nukleinowy z (a), dodatkowo zawierający heterologiczną sekwencję kwasu nukleinowego lub peptyd sygnałowy, (c) kwas nukleinowy z (b), przy czym sekwencja heterologiczna kwasu nukleinowego zawiera lub składa się z sekwencji kwasu nukleinowego kodującej: (i) heterologiczną sekwencję sygnałową (liderową), heterologiczną sekwencję sygnałową (liderową) fosfolipazy lub heterologiczną sekwencję sygnałową (liderową) niefosfolipazy, lub (ii) domenę katalityczną, sekwencję łącznikową, miejsce rozpoznawania rozszczepienia proteazy, sekwencję enzymu niefosfolipazy lub sekwencję enzymu fosfolipazy, lub (d) kwas nukleinowy zawierający sekwencję całkowicie (w pełni) komplementarną z sekwencją kwasu nukleinowego według dowolnego z (a) do (c). 3. Kaseta ekspresyjna, wektor lub nośnik do klonowania zawierające kwas nukleinowy, zawierający (a) kwas nukleinowy zawierający sekwencję określoną zastrzeżeniem 1 albo 2, lub (b) kasetę ekspresyjną, wektor lub nośnik do klonowania z (a), przy czym nośnik do klonowania obejmuje wektor wirusowy, plazmid, fag, fagemid, kosmid, fosmid, bakteriofag lub sztuczny chromosom, lub wektor wirusowy obejmuje wektor adenowirusowy, wektor retrowirusowy lub wektor wirusowy związany z adenowirusem, albo wektor lub nośnik do klonowania zawiera lub jest zawarte w sztucznym chromosomie bakteryjnym (BAC), plazmidzie, wektorze pochodzącym z bakteriofaga P1 (PAC), sztucznym chromosomie drożdżowym (YAC), lub sztucznym chromosomie ssaczym (MAC). 4. Transformowana komórka zawierającą (a) kwas nukleinowy zawierający sekwencję określoną zastrzeżeniem 1 albo 2, lub kasetę ekspresyjną, wektor lub nośnik do klonowania określone zastrzeżeniem 3, lub (b) transformowaną komórkę z (a), przy czym komórką jest komórka bakteryjna, komórka ssacza, komórka grzybowa, komórka drożdżowa, komórka owadzia lub komórka roślinna. 5. Transgeniczne zwierzę inne niż człowiek zawierające -363- (a) sekwencję określoną zastrzeżeniem 1 albo 2, lub (b) transgeniczne zwierzę inne niż człowiek z (a), przy czym zwierzęciem jest mysz, koza, królik, owca, świnia lub krowa. 6. Transgeniczna roślina lub nasiono zawierające (a) sekwencję określoną zastrzeżeniem 1 albo 2, lub (b) transgeniczną roślinę lub nasiono (a), przy czym rośliną jest roślina kukurydzy, roślina sorgo, roślina ziemniaka, roślina pomidora, roślina pszenicy, roślina oleista, roślina rzepaku, roślina soi, roślina ryżu, roślin jęczmienia, trawa, nasiono bawełny, palma, roślina sezamu, roślina orzeszka ziemnego, roślina słonecznika lub roślina tytoniu, lub (c) transgeniczną roślinę lub nasiono z (a), przy czym nasionem jest nasiono kukurydzy, ziarno pszenicy, nasiono oleiste, nasiono rzepaku, nasiono soi, ziarno palmy, nasiono słonecznika, nasiono sezamu, ryż, jęczmień, orzeszek ziemny, nasiono bawełny, palma, orzeszek ziemny, nasiono sezamu, nasiono słonecznika lub nasiono rośliny tytoniu. 7. Wyizolowany, syntetyczny lub rekombinowany polipeptyd mający aktywność fosfolipazy zawierający: (a) polipeptyd mający 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do sekwencji, jak przedstawionej na aminokwasach WSAEDKHNEGINSHLWIVNRAIDIMSRNTTIVNPNETALLNEWRADLENGIYS ADYENP YYDDSTYASHFYDPDTGTTYIPFAKHAKETGAKYFNLAGQAYQNQDMQQAF FYLGLSL HYLGDVNQPMHAASFTDLSYPMGFHSKYENFVDTIKNNYIVSDSNGYWNWK GANPED WIEGAAVAAKQDYPGVVNDTTKDWFVKAAVSQEYADKWRAEVTPVTGKRL MEAQR VTAGYIHLWFDTYVNR, przy czym aminokwasem pozycji 63 jest D (Kwas asparaginowy), aminokwasem pozycji 131 jest S (Seryna) i aminokwasem pozycji 134 jest D (Kwas asparaginowy), przy czym pierwszy aminokwas W (tryptofan) liczony jest jako pozycja 1, (b) polipeptyd kodowany przez kwas nukleinowy określony zastrzeżeniem 1. 8. Wyizolowany, syntetyczny lub rekombinowany polipeptyd mający aktywność fosfolipazy zawierający: (a) polipeptyd mający 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, lub więcej identyczności sekwencji do sekwencji jak przedstawionej na aminokwasach WSAEDKHNEGINSHLWIVNRAIDIMSRNTTIVNPNETALLNEWRADLENGIYS ADYENP YYDDSTYASHFYDPDTGTTYIPFAKHAKETGAKYFNLAGQAYQNQDMQQAF -364- FYLGLSL HYLGDVNQPMHAASFTDLSYPMGFHSKYENFVDTIKNNYIVSDSNGYWNWK GANPED WIEGAAVAAKQDYPGVVNDTTKDWFVKAAVSQEYADKWRAEVTPVTGKRL MEAQR VTAGYIHLWFDTYVNR, przy czym aminokwasem pozycji 63 jest D (Kwas asparaginowy) i aminokwasem pozycji 134 jest D (Kwas asparaginowy) i przy czym (i) aminokwas pozycji 131 jest zmodyfikowany do jednej z następujących reszt: Lizyna (K); Glicyna (G); Arginina (R); Glutamina (Q); Alanina (A); Izoleucyna (I); Histydyna (H); Fenyloalanina (F); Treonina (T); Metionina (M) Leucyna (L), przy czym wariantowa fosfolipaza ma zwiększoną oporność na proteazę, lub (ii) aminokwas pozycji 131 jest zmodyfikowany do jednej z następujących reszt: Tryptofan (W); Glutaminian (E); Tyrozyna (Y), przy czym wariantowa fosfolipaza ma zmniejszoną oporność na proteazę, przy czym pierwszy aminokwas W (tryptofan) liczony jest jako pozycja 1, (b) polipeptyd kodowany przez kwas nukleinowy określony zastrzeżeniem 2. 9. Polipeptyd według zastrz. 7 albo 8, przy czym (a) polipeptyd ponadto zawiera heterologiczną sekwencję aminokwasową lub heterologiczny peptyd sygnałowy, (b) polipeptyd z (a), przy czym heterologiczny polipeptyd zawiera lub składa się z: (i) heterologicznej sekwencji sygnałowej (liderowej), heterologicznej sekwencji sygnałowej (liderowej) fosfolipazy lub heterologicznej sekwencji sygnałowej (liderowej) niefosfolipazy, lub (ii) domeny katalitycznej, sekwencji łącznikowej, miejsca rozpoznawania rozszczepienia proteazy, sekwencji enzymu niefosfolipazy lub sekwencji enzymu fosfolipazy, (c) polipeptyd z (a) lub (b), przy czym polipeptyd zawiera co najmniej jedno miejsce glikozylacji, lub glikozylacja jest N-glikozylacją, lub polipeptyd jest glikozylowany po ekspresji w P. pastoris lub S. pombe; lub (d) polipeptyd z dowolnego z (a) do (c), przy czym polipeptyd zawiera co najmniej jedną modyfikację obejmującą lub składającą się z acetylowania, acylowania, ADPribozylowania, amidowania, kowalencyjnego przyłączania flawiny, kowalencyjnego przyłączania ugrupowania hemowego, kowalencyjnego przyłączania nukleotydu lub pochodnej nukleotydu, kowalencyjnego przyłączenia lipidu lub pochodnej lipidu, kowalencyjnego przyłączenia fosfatydyloinozytolu, cyklizacji krzyżowej, tworzenia wiązań dwusiarczkowych, demetylowania, tworzenia kowalencyjnych wiązań krzyżowych, tworzenia cysteiny, tworzenia piroglutaminianu, formylowania, gammakarboksylowania, glikozylowania, tworzenia kotwicy GPI, hydroksylowania, jodowania, metylowania, mirystolilowania, utleniania, pegylowania, obróbki proteolitycznej, fosforylowania, prenylowania, racemizacji, selenoilowania, siarczanowania, addycji za pośrednictwem transferowego RNA aminokwasu lub arginylowania. -365- 10. Sposób wytwarzania rekombinowanego polipeptydu mającego aktywność fosfolipazy, obejmujący: (A) (a) zapewnianie kwasu nukleinowego, przy czym kwas nukleinowy zawiera sekwencję określoną zastrzeżeniem 1 albo 2; i (b) eksprymowanie kwasu nukleinowego z etapu (a) w warunkach, które pozwalają na ekspresję polipeptydu, w ten sposób wytwarzając rekombinowany polipeptyd, lub (B) sposób z (A), przy czym sposób dodatkowo obejmuje transformowanie komórki gospodarza kwasem nukleinowym z etapu (a) i następnie eksprymowanie kwasu nukleinowego z etapu (a), w ten sposób wytwarzając rekombinowany polipeptyd w transformowanej komórce, lub (C) sposób z (B), przy czym komórką gospodarza jest szczep Pichia z fenotypem Mut+, lub (D) sposób z (C), przy czym sposób dodatkowo obejmuje suplementowanie warunków hodowli cynkiem. 11. Sposób hydrolizowania kompozycji zawierającej fosfolipid obejmujący: (A) (a) zapewnianie polipeptydu mającego aktywność fosfolipazy określonego dowolnym z zastrzeżeń 7 do 9, lub polipeptydu kodowanego przez kwas nukleinowy określony zastrzeżeniem 1 albo 2; (b) zapewnianie kompozycji zawierającej fosfolipid; i (c) kontaktowanie polipeptydu z etapu (a) z kompozycją z etapu (b) w warunkach, w których fosfolipaza hydrolizuje kompozycję zawierającą fosfolipid, lub (B) sposób z (A), przy czym kompozycja zawiera zawierającą fosfolipid dwuwarstwę lipidową lub błonę, kompozycja zawiera komórkę roślinną, komórkę bakteryjną, komórkę drożdżową, komórkę owadzią lub komórkę zwierzęcą, lub (C) sposób z (A), przy czym sposób obejmuje zastosowanie mieszania przy wysokim ścinaniu kompozycji, a następnie mieszanie przy braku lub niskim ścinaniu z co najmniej jednym polipeptydem według wynalazku mającym aktywność fosfolipazy aby umożliwić odpowiednie kontaktowanie substratu fosfolipidu z fosfolipazą. 12. Sposób odśluzowywania tłuszczu lub oleju, obejmujący: (A) (a) zapewnianie kompozycji zawierającej polipeptyd mający aktywność fosfolipazy określony dowolnym z zastrzeżeń 7 do 9, lub polipeptyd kodowany przez kwas nukleinowy określony zastrzeżeniem 1 albo 2; -366- (b) zapewnianie kompozycji zawierającej tłuszcz lub olej; i (c) kontaktowanie polipeptydu z etapu (a) i kompozycji z etapu (b), lub (B) sposób z (A), przy czym polipeptyd hydrolizuje fosfatyd z ulegającego uwodnieniu i/lub nieulegającego uwodnieniu fosfolipidu w tłuszczu lub oleju, lub polipeptyd hydrolizuje fosfatyd przy wiązaniu fosfoestrowym glicerolu do generowania diglicerydu i rozpuszczalnego w wodzie związku fosforanowego, lub (C) sposób z dowolnego z (A) lub (B), przy czym warunki etapu (c) obejmują temperaturę 20°C do 40°C w alkalicznym pH, lub warunki alkaliczne obejmują pH o pH 8 do pH 10, lub (D) sposób z dowolnego z (A) do (C), przy czym warunki obejmują alkaliczne pH, lub warunki hydrolizy z etapu (c) obejmują czas reakcji 3 do 10 minut, lub warunki hydrolizy z etapu (c) obejmują hydrolizę ulegających uwodnieniu i nieulegających uwodnieniu fosfolipidów w oleju w temperaturze 50°C do 60°C, w pH o pH 5 do pH 6,5, w pH o pH 6,0 do pH 7,5, lub w pH o pH 5 do pH 8,0, stosując czas reakcji 30 do 60 minut, lub alkaliczne warunki są wystarczające do spowodowania izomeryzacji 1,2-DAG wytworzonego przez PLC do 1,3-DAG, lub (E) sposób z dowolnego z (A) do (D), przy czym polipeptyd jest związany z filtrem i tłuszcz lub olej przepuszcza się przez filtr, lub polipeptyd dodaje się do roztworu zawierającego tłuszcz lub olej, a następnie roztwór przepuszcza się przez filtr, lub (F) sposób z (A) lub (E), przy czym sposób dodatkowo obejmuje dodanie jednego lub więcej polipeptydów mających proteazę, amylazę, lipazę, kutynazę, kolejną fosfolipazę, karbohydrazę, celulazę, pektynazę, mannanazę, arabinazę, galaktanazę, ksylanazę, oksydazę, np. laktazę, i/lub peroksydazę, lub ich kombinacji, aby dalej rozkładać masę substancji śluzowych i zwiększać wydajności oleju. 13. Sposób przekształcania nieulegającego uwodnieniu fosfolipidu do postaci ulegającej uwodnieniu, obejmujący: (A) (a) zapewnianie kompozycji zawierającej polipeptyd mający aktywność fosfolipazy określony dowolnym z zastrzeżeń 7 do 9, lub polipeptyd kodowany przez kwas nukleinowy określony zastrzeżeniem 1 albo 2; (b) zapewnianie kompozycji zawierającej nieulegający uwodnieniu fosfolipid; i (c) kontaktowanie polipeptydu z etapu (a) i kompozycji z etapu (b) w warunkach, w których polipeptyd przekształca nieulegający uwodnieniu fosfolipid do postaci ulegającej uwodnieniu. 14. Sposób oczyszczania sterolu roślinnego z oleju roślinnego obejmujący: (A) -367- (a) zapewnianie kompozycji zawierającej polipeptyd mający aktywność fosfolipazy określony dowolnym z zastrzeżeń 7 do 9, lub polipeptyd kodowany przez kwas nukleinowy określony zastrzeżeniem 1 albo 2; (b) zapewnianie oleju roślinnego zawierającego sterol roślinny; i (c) kontaktowanie polipeptydu z etapu (a) z olejem roślinnym z etapu (b , przy czym sposób obejmuje zastosowanie niepolarnych rozpuszczalników do ilościowego ekstrahowania wolnego roślinnego sterolu lub estrów kwasów tłuszczowych roślinnego sterolu, lub (B) sposób z (A), przy czym sterol roślinny obejmuje ?-sitosterol, kampesterol, stigmasterol, stigmastanol, ?-sitostanol, sitostanol, desmosterol, chalinasterol, poriferasterol, clionasterol lub brasykasterol. 15. Kompozycja zawierająca polipeptyd określony dowolnym z zastrzeżeń 7 do 9, lub polipeptyd kodowany przez sekwencję kwasu nukleinowego (polinukleotyd) określony zastrzeżeniem 1 albo 2. 16. Kompozycja według zastrz. 15, przy czym kompozycja jest farmaceutyczna, detergentu, biomasy lub biodiesela. 17. Sposób deacylowania łańcucha kwasu tłuszczowego 2' lub 3' z lipidu A obejmujący kontaktowanie lipidu A z polipeptydem określonym dowolnym z zastrzeżeń 7 do 9, lub polipeptydem kodowanym przez kwas nukleinowy określony zastrzeżeniem 1 albo 2. 18. Sposób zmniejszania masy substancji śluzowatej i podwyższania przyrostu obojętnego oleju (trójglicerydu) poprzez zmniejszone pułapkowanie oleju obejmujący: (a) zapewnianie kompozycji zawierającej polipeptyd mający aktywność fosfolipazy określony dowolnym z zastrzeżeń 7 do 9, lub polipeptyd kodowany przez kwas nukleinowy określony zastrzeżeniem 1 albo 2; (b) zapewnianie kompozycji zawierającej tłuszcz lub olej zawierający fosfolipid; i (c) kontaktowanie polipeptydu z etapu (a) i kompozycji z etapu (b) w warunkach, w których polipeptyd może katalizować hydrolizę fosfolipidu w kompozycji przez czas wystarczający do zmniejszenia masy substancji śluzowatej i podwyższenia neutralnych olejów. 19. Układ komórkowy do ekspresji białka heterologicznego, zawierający (a) komórki szczepu Pichia oporne na zeocynę, przy czym białko heterologiczne jest kodowane przez kwas nukleinowy zawierający kwas nukleinowy określony zastrzeżeniem 1 albo 2, lub białko heterologiczne zawiera polipeptyd określony dowolnym z zastrzeżeń 7 do 9; lub (b) szczep Pichia fenotypu Mut+ zawierający heterologiczny kwas nukleinowy kodujący fosfolipazę C funkcjonalnie połączony z promotorem funkcjonalnym w -368- szczepie Pichia, przy czym kwas nukleinowy kodujący fosfolipazę C zawiera kwas nukleinowy określony zastrzeżeniem 1 albo 2. -369- -370- -371- -372- -373- -374- -375- -376- -377- -378- -379- -380- -381- -382- -383- -384- -385- -386- -387- -388- -389- -390- -391- -392- -393- -394- -395- -396- -397- -398- -399- -400- -401- -402- -403- -404- -405- -406- -407- -408- -409- -410- -411-
Grupy dyskusyjne